BioLiP

>protein
IVDLRGMWVGVAGLNIFYLIVRIYEQIYGWRAGLDSFAPEFQTYWLSILWTEIPLELVSGLALAGWLWKTRDRNVDAVAP
REELRRHVVLVEWLVVYAVAIYWGASFFTEQDGTWHMTVIRDTDFTPSHIIEFYMSYPIYSIMAVGAFFYAKTRIPYFA

The query sequence (length=159) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3chx:C	159	159	1.0000	1.0000	1.0000	5.45e-115	3chx:G, 3chx:K
2	4pi0:C	217	159	0.8805	0.6452	0.8805	4.85e-98	4phz:C, 4phz:G, 4phz:K, 4pi0:G, 4pi0:K, 3rfr:C, 3rfr:G, 3rfr:K
3	7s4m:K	241	159	0.8805	0.5809	0.8805	5.12e-97	4pi2:C, 4pi2:G, 4pi2:K, 7s4m:G, 7s4m:C
4	1yew:C	188	159	0.6415	0.5426	0.6415	2.17e-71	1yew:G, 1yew:K
5	3rgb:C	213	159	0.6415	0.4789	0.6415	4.27e-71	3rgb:K, 3rgb:G
6	8oyi:C	236	159	0.6415	0.4322	0.6415	1.45e-70	8oyi:G, 8oyi:K, 7s4h:C, 7s4h:G, 7s4h:K, 7s4i:C, 7s4i:G, 7s4i:K, 7s4j:C, 7s4j:G, 7s4j:K, 7s4k:C, 7s4k:G, 7s4k:K, 8sqw:C, 8sqw:G, 8sqw:K, 8sr1:C, 8sr1:G, 8sr1:K, 8sr2:C, 8sr2:G, 8sr2:K, 8sr4:C, 8sr4:G, 8sr4:K, 7t4p:C, 7t4p:G, 7t4p:K
7	7s4l:C	231	141	0.5535	0.3810	0.6241	1.21e-62	7s4l:H, 7s4l:I
8	6cxh:C	101	36	0.1195	0.1881	0.5278	3.69e-06
9	7kgg:C	1020	58	0.1195	0.0186	0.3276	0.53	7kgh:C, 7kgi:A, 7kgi:C
10	8ee7:A	456	77	0.1195	0.0417	0.2468	1.2	8ee4:A, 8ee4:B, 8ee4:C, 8ee4:D, 8ee4:E, 8ee4:F, 8ee7:B, 8eea:A, 8eea:B, 8eea:C, 8eea:D, 8eea:E, 8eea:F, 8sux:A, 8sux:B, 8sux:C, 8sux:D, 8sux:E, 8sux:F
11	3sp4:B	204	41	0.1006	0.0784	0.3902	5.3	3sp4:A, 3spd:A, 3spd:B, 3spd:C, 3spd:D, 3spl:A, 3spl:B, 3spl:C, 3spl:D, 3szq:A, 4xba:A, 4xba:B, 4ykl:B
12	8r3p:A	672	32	0.0755	0.0179	0.3750	9.8	8r3p:B, 8r3p:C, 8r3p:D

[Back]