BioLiP

>protein
ISTGVFDHLPFQHRRQHAFNTLPLHDANHFGGRTAYLREIGPVNIKKSGRRFKKDLRTVQFNVDIWCAQQTLRKRWKQRD
WEVIEVPFRLAPAEQQRVIPEMYTDVPPMTDPERHDFSNIRNKVYDREELQGVLFGASGPLPYPPLQRIDRQAMTLDKFL

The query sequence (length=160) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7aor:aw	160	160	1.0000	1.0000	1.0000	1.19e-119
2	6hiv:DV	160	160	0.8250	0.8250	0.8250	4.74e-99	6hiw:DV, 6hiz:DV, 7pua:DV, 7pub:DV, 6sg9:DV, 6sgb:DV
3	7ane:aw	139	139	0.5938	0.6835	0.6835	9.92e-71
4	6pd0:A	366	19	0.0688	0.0301	0.5789	1.4	6pcz:A, 6pcz:B, 6pd0:B
5	5olt:A	383	19	0.0750	0.0313	0.6316	1.5	5ojh:A
6	8quc:A	395	69	0.1250	0.0506	0.2899	2.5	8f1c:A, 8f1c:B, 8f1c:C, 8f1c:D, 8f1d:A, 8f1d:B, 8f1d:C, 8f1d:D, 7phi:C, 7phi:B, 7phi:D, 8quc:B, 8quc:D, 8quc:C, 8qud:A, 8qud:B, 8qud:C, 8qud:D
7	5ctn:A	233	60	0.0938	0.0644	0.2500	3.3	5ctn:B
8	8iau:H	412	94	0.1625	0.0631	0.2766	3.6
9	8iav:A	451	94	0.1625	0.0576	0.2766	3.7	8iav:B
10	4rn7:A	186	23	0.0625	0.0538	0.4348	3.9
11	8iav:C	460	94	0.1625	0.0565	0.2766	3.9	8iav:D
12	8dmu:A	476	54	0.1062	0.0357	0.3148	4.0	8dmu:B, 8dmu:C, 8dmu:D
13	8iat:A	501	94	0.1625	0.0519	0.2766	9.0	8iat:B, 8iat:C, 8iat:D, 8iau:A, 8iau:B, 8iau:C, 8iau:D, 8iau:E, 8iau:F, 8iau:G, 8iaw:A, 8iaw:B, 8iax:A, 8iax:B, 8iax:C, 8iax:D, 8iax:E, 8iax:F, 8iax:G, 8iax:H, 8xw6:A, 8xw6:B, 8xw7:A, 8xw7:B, 8xw8:A, 8xw8:B, 8xw8:C, 8xw8:D, 8xw9:A, 8xw9:B, 8zly:A, 8zly:B, 8zly:C, 8zly:D, 8zly:E, 8zly:F, 8zly:G, 8zly:H
14	351c:A	82	25	0.0688	0.1341	0.4400	9.2	451c:A, 1dvv:A, 2exv:A, 2exv:C, 2pac:A, 3x39:A, 3x39:B

[Back]