ISSETGEMGILWEFDPIINKWIRLSMKLKVERKPFAEGALREAYHTVSLGVGTDENYPLLFPPIEMISPISKNNEAMTQL
KNGTKFVLKLYKASRELYFEDVKMQMVCRDWGNKFNQKKPPKKIEFLMSWVVELIDRSPPILCSIEPLLVGEFKKNNSNY
GAVLTNRSTPQAFSHFTYELSNKQMIVVDIQGVDDLYTDPQIHTPDGKGFGLGNLGKAGINKFITTHKCNAVCALLDLDV
The query sequence (length=240) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4zme:A | 262 | 253 | 1.0000 | 0.9160 | 0.9486 | 9.65e-176 | 5dyj:A, 5dyj:B, 5e4h:A, 5e4h:B, 5e4h:C, 5e4h:D, 5e4h:E, 5e4h:F, 5e4h:G, 5e4h:H, 5e9e:A, 5e9e:B, 3lkm:A, 3lla:A, 3lla:B, 3lmh:A, 3lmh:B, 3lmi:A, 3lmi:B, 3lmi:C, 3lmi:D, 3pdt:A, 4zme:B, 4zmf:A, 4zmf:B, 4zs4:A, 4zs4:B |
2 | 8gm4:A | 462 | 228 | 0.3750 | 0.1948 | 0.3947 | 3.43e-50 | |
3 | 8fny:A | 497 | 229 | 0.3708 | 0.1791 | 0.3886 | 3.50e-49 | 8fny:C, 8fo6:A, 8gm5:A, 7shq:A |
4 | 4kuj:B | 268 | 268 | 0.2875 | 0.2575 | 0.2575 | 1.26e-17 | 4kuj:A, 4nl0:A, 4nl0:B |
5 | 1ia9:B | 280 | 155 | 0.2125 | 0.1821 | 0.3290 | 6.03e-16 | 1ia9:A, 1iah:A, 1iah:B, 1iaj:B |
6 | 1iaj:A | 253 | 159 | 0.1917 | 0.1818 | 0.2893 | 1.25e-11 | |
7 | 3gon:A | 329 | 53 | 0.0667 | 0.0486 | 0.3019 | 0.90 | |
8 | 3gqo:A | 161 | 71 | 0.0833 | 0.1242 | 0.2817 | 5.4 | 3gqo:B, 3gqo:C, 3gqo:D, 5mqx:A |
9 | 7d6v:C | 264 | 32 | 0.0542 | 0.0492 | 0.4062 | 7.0 | 7d6x:C |