ISLEQIDGFAAKSFPLCMRQLHKSLRENHHLRHGGRMQYGLFLKGIGLTLEQALQFWRLEFTKGKVDSEKFDKVYAYSIR
HNYGKEGKRTDYTPYSCMKVILSNPPSQGDYHGCPFRHSDPELLKQKLQSFKVPSSGINQILELVKGMHYQLACQKYFEL
THSVDDCGFSLNHPNQYFAESQKLLT
The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8g99:C | 381 | 185 | 0.9946 | 0.4856 | 1.0000 | 1.44e-138 | |
2 | 8g9f:C | 446 | 185 | 0.9946 | 0.4148 | 1.0000 | 5.83e-138 | 8g9l:B, 8g9o:B, 8ucv:B, 8v6g:C, 8v6h:C, 8v6i:C, 8v6j:C |
3 | 9c8v:B | 434 | 185 | 0.7957 | 0.3410 | 0.8000 | 1.81e-113 | 8d0k:E, 8d96:B, 8d9d:B, 5exr:B, 5exr:F, 5f0q:A, 5f0q:B, 5f0s:A, 5f0s:B, 3l9q:A, 7opl:D, 3q36:A, 3q36:B, 8qj7:D, 4rr2:D, 7u5c:B, 8vy3:B |
4 | 6dhw:A | 170 | 186 | 0.7204 | 0.7882 | 0.7204 | 1.39e-98 | 6dhw:B, 5dqo:A, 5dqo:B, 5dqo:C, 5dqo:D, 5i7m:A, 5i7m:B, 3l9q:B |
5 | 8foc:B | 450 | 174 | 0.4355 | 0.1800 | 0.4655 | 2.28e-47 | 6di2:A, 6di6:A, 6dtv:A, 6dtz:A, 6du0:A, 8fod:B, 8foh:B, 8foj:B, 8fok:B, 3lgb:A, 3lgb:B, 7tl2:A, 7tl3:A, 7tl4:A |
6 | 8foe:B | 370 | 175 | 0.3333 | 0.1676 | 0.3543 | 1.79e-26 | |
7 | 6idx:A | 501 | 45 | 0.0914 | 0.0339 | 0.3778 | 2.3 |