IRRLILAFILPPAAVMNKEAGTIMLTGILTLWGWIPGVVAALIMISKEQS
The query sequence (length=50) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8gwa:F | 50 | 50 | 1.0000 | 1.0000 | 1.0000 | 1.38e-29 | 7ueb:F |
| 2 | 5d76:B | 232 | 25 | 0.1800 | 0.0388 | 0.3600 | 4.1 | 5d76:A |
| 3 | 7pm4:A | 431 | 19 | 0.2200 | 0.0255 | 0.5789 | 10.0 | 7pm4:B, 7pm4:C, 7pm4:D |
zhanggroup.org