Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
IRLTNQLKSLKGLQSKLKDVVEYLDKVIHTILGKLQDVFNLNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQ
NKKIQEQRVKD

The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 3j47:U 91 91 1.0000 1.0000 1.0000 7.29e-59
2 8tc0:B 1091 66 0.2308 0.0192 0.3182 1.6 8tc0:A, 8tc0:C, 8tc1:C, 8tc1:A, 8tc1:B, 8tc5:C, 8tc5:A, 8tc5:B, 1zv8:A, 1zv8:C, 1zv8:E, 5zvm:A, 5zvm:B
3 7tei:B 1042 66 0.2308 0.0202 0.3182 1.9
4 8hlc:A 1081 71 0.2418 0.0204 0.3099 3.9 7e7d:A, 7e7d:B, 7e7d:C, 8h3e:A, 8h3e:B, 8h3e:C, 8hlc:B, 8hlc:C, 7odl:A, 7odl:B, 7odl:C, 7wgx:A, 7wgx:B, 7wgx:C, 6zb4:C, 6zb4:B, 6zb4:A, 6zoz:A, 6zoz:B, 6zoz:C
5 7od3:A 1012 64 0.2198 0.0198 0.3125 4.9 7od3:B, 7od3:C
6 8xus:B 1063 66 0.2308 0.0198 0.3182 6.9 8if2:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417