Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
IPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERW
QPDTEEEYEDSSGNVVNKKTY

The query sequence (length=101) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6ff7:9 432 101 1.0000 0.2338 1.0000 1.11e-73
2 8i0p:w 434 101 1.0000 0.2327 1.0000 1.27e-73 7abh:4, 7abi:4, 7evo:C, 8hk1:C, 8i0r:w, 8i0s:w, 8i0t:w, 8i0u:w, 7onb:N, 7q3l:9, 7q4o:9, 7q4p:9, 6qx9:A3, 8r08:9, 8rm5:9, 7vpx:C, 6y50:9
3 6ah0:w 443 101 0.8416 0.1919 0.8416 1.57e-57 6ahd:w, 8ch6:J, 8h6e:2F, 8h6j:2F, 8h6k:2F, 8h6l:2F, 7qtt:J, 5z56:w, 5z57:w, 5z58:w
4 6g90:T 462 101 0.4257 0.0931 0.4257 3.26e-23 7dco:u, 4dgw:A, 5nrl:T, 5zwm:u
5 3emr:A 279 55 0.1188 0.0430 0.2182 0.79
6 8ccn:A 372 18 0.0891 0.0242 0.5000 8.2 4cbx:A, 8ccn:B, 8ccn:C, 8ccn:D, 8ccn:E, 8ccn:F, 8cco:A, 8cco:B, 8cco:C, 8cco:D, 8cco:E, 8cco:F, 6i4m:A
7 3jb9:Y 261 38 0.1386 0.0536 0.3684 9.3

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218