IPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREAR
The query sequence (length=39) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8s8o:A | 52 | 39 | 0.9744 | 0.7308 | 0.9744 | 2.71e-22 | 2drn:A, 2drn:B, 2h9r:B, 2hwn:A, 2hwn:B, 2hwn:C, 2hwn:D, 2izx:A, 2izx:B, 8s8o:B, 3tmh:B, 3tmh:G, 4zp3:A, 4zp3:B, 4zp3:C, 4zp3:D, 4zp3:E, 4zp3:F, 4zp3:L, 4zp3:I, 4zp3:J, 4zp3:K |
2 | 8q0n:B | 831 | 24 | 0.2308 | 0.0108 | 0.3750 | 6.1 | |
3 | 6g0c:A | 624 | 27 | 0.2308 | 0.0144 | 0.3333 | 7.6 | |
4 | 1bp3:B | 197 | 23 | 0.2308 | 0.0457 | 0.3913 | 8.3 | 3d48:R |
5 | 1fx7:A | 230 | 34 | 0.3333 | 0.0565 | 0.3824 | 9.3 | 1b1b:A, 1fx7:B, 1fx7:C, 1fx7:D, 2isz:A, 2isz:B, 2isz:C, 2isz:D, 2it0:A, 2it0:B, 2it0:C, 2it0:D, 1u8r:A, 1u8r:B, 1u8r:C, 1u8r:D, 1u8r:G, 1u8r:H, 1u8r:I, 1u8r:J |
6 | 6bq1:E | 1510 | 22 | 0.2564 | 0.0066 | 0.4545 | 9.7 | 6bq1:A |
7 | 2yev:A | 780 | 29 | 0.2821 | 0.0141 | 0.3793 | 9.7 | 2yev:D |
8 | 8fkt:SY | 378 | 18 | 0.2564 | 0.0265 | 0.5556 | 9.9 | 8fku:SY, 8fkv:SY, 8fkw:SY, 8fkx:SY, 8fky:SY |
9 | 2wzv:B | 223 | 13 | 0.2308 | 0.0404 | 0.6923 | 10.0 | 2wzv:A, 2wzw:A, 2wzw:B |