IKQLFTHTQTVTSEFIDHNNHMHDANYNIIFSDVVNRFNYSHFTLEEHTTYLSELSLGDVFTVTLYIYDYDYKRLHLFLT
LTKEDGTLASTNEVMMIAHYYKNQPTITWPEQLGHKIAIP
The query sequence (length=120) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5eo2:D | 120 | 120 | 1.0000 | 1.0000 | 1.0000 | 1.30e-86 | |
2 | 5eo2:C | 158 | 154 | 1.0000 | 0.7595 | 0.7792 | 2.09e-78 | 5eo2:B, 5eo2:E, 5eo2:F |
3 | 5eo2:A | 133 | 136 | 0.9750 | 0.8797 | 0.8603 | 2.87e-76 | |
4 | 2np0:A | 1289 | 61 | 0.1583 | 0.0147 | 0.3115 | 0.46 | 1epw:A, 2etf:A, 2etf:B, 1f31:A, 1f82:A, 6g5f:B, 6g5g:B, 6g5k:A, 6g5k:B, 1g9a:A, 1g9b:A, 1g9c:A, 1g9d:A, 1i1e:A, 4kbb:A, 4kbb:B, 7na9:A, 2nm1:A, 6qns:A, 1s0b:A, 1s0c:A, 1s0d:A, 1s0e:A, 1s0f:A, 7t5f:A, 7t5f:D, 2xhl:A, 3zuq:A, 6zvm:AAA |
5 | 3ldf:A | 380 | 101 | 0.2417 | 0.0763 | 0.2871 | 4.0 | |
6 | 7sze:B | 329 | 109 | 0.2500 | 0.0912 | 0.2752 | 5.9 | 7sze:A, 7sze:C, 7szf:A, 7szf:B, 7szf:C, 7szg:A, 7szg:B, 7szg:C, 6wnc:A, 6wnc:B, 6wnc:C, 6wnd:A, 6wnd:B, 6wnd:C |
7 | 8zmr:A | 384 | 52 | 0.1333 | 0.0417 | 0.3077 | 9.5 |