BioLiP

>protein
IKQKLETQFTCLFCNHDNSVVCTLDKKNSIGLLECKKCNLSFQAPINSLSQPIDIYSDWIDACE

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8he5:M	64	64	1.0000	1.0000	1.0000	1.52e-42	6ir9:M, 6j4w:M, 6j4x:M, 6j4y:M, 6j51:M, 8jh2:M, 7wbv:M, 7wbx:M, 7xn7:M, 5xog:M, 7xse:M, 7xsx:M, 7xsz:M, 7xt7:M, 7xtd:M, 7xti:M
2	1wii:A	85	60	0.5156	0.3882	0.5500	3.73e-21	8b3d:M, 8b3f:M
3	7olc:Lp	91	45	0.2031	0.1429	0.2889	0.038	8ia0:Lp, 7old:Lp, 8oo0:Lp, 8pv1:Lp, 8pv2:Lp, 8pv3:Lp, 8pv4:Lp, 8pv5:Lp, 8pv6:Lp, 8pv7:Lp, 8pv8:Lp, 8pvk:Lp, 8pvl:Lp, 7r81:r1, 7z3n:Lp, 7z3o:Lp
4	5xy3:p	89	48	0.1719	0.1236	0.2292	0.20
5	8u7h:C	1111	67	0.2969	0.0171	0.2836	0.58
6	8smc:C	1084	67	0.2969	0.0175	0.2836	0.62
7	4v4n:Ai	78	62	0.1875	0.1538	0.1935	2.1	4v6u:Bi
8	4xsv:A	306	27	0.1562	0.0327	0.3704	2.7	3elb:A
9	9ezy:B	657	19	0.1250	0.0122	0.4211	3.2
10	5u2o:A	543	27	0.1562	0.0184	0.3704	3.9
11	6vno:A	1084	48	0.2500	0.0148	0.3333	5.4	6vp6:A
12	8tzb:A	920	48	0.2500	0.0174	0.3333	6.2
13	7l48:A	522	43	0.2344	0.0287	0.3488	6.5	7c7l:A, 7l48:B, 7l49:A, 7l49:B
14	8tyq:A	957	48	0.2500	0.0167	0.3333	6.5	8tze:A
15	8fo9:A	1173	70	0.3125	0.0171	0.2857	6.7	8fo9:C
16	6rm3:LPP	83	57	0.2188	0.1687	0.2456	7.2

[Back]