IKFELIDVPIPQGTNVIIGQAHFIKTVEDLYEALVTSVPGVKFGIAFCEASGKRLVRHEANDEELRNLAIDLCKKIAAGH
VFVIYIRNAWPINVLNAIKNVPEVVRIFAATANPLKVIVAEVEPERRGVVGVVDGHSPLGVETEKDREERKKFLREVVKY
KL
The query sequence (length=162) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2gl0:B | 163 | 162 | 1.0000 | 0.9939 | 1.0000 | 1.04e-115 | 2gl0:C, 2gl0:A, 2gl0:E, 2gl0:F, 2gl0:D, 2jb7:A, 2jb7:C, 2jb7:B |
2 | 1csn:A | 293 | 45 | 0.0926 | 0.0512 | 0.3333 | 2.7 | 2csn:A, 1eh4:A, 1eh4:B |
3 | 8a5e:A | 583 | 48 | 0.0802 | 0.0223 | 0.2708 | 3.5 | 8a5e:D, 7q4v:A, 7q4v:E, 7q4w:A, 7q4w:E |
4 | 3d03:A | 274 | 41 | 0.0679 | 0.0401 | 0.2683 | 3.7 | 3d03:B, 3d03:C, 3d03:D, 3d03:E, 3d03:F, 2dxl:A, 2dxl:B, 2dxn:A, 2dxn:B, 2zo9:B, 2zo9:C, 2zoa:A, 2zoa:B |
5 | 7bkb:H | 438 | 110 | 0.1667 | 0.0616 | 0.2455 | 3.7 | 7bkb:h, 7bkc:H, 7bkc:h |
6 | 5xt2:B | 204 | 99 | 0.1420 | 0.1127 | 0.2323 | 5.8 | 5xt2:A, 5xt2:C, 5xt2:D, 5xt2:E |
7 | 4v6w:CF | 229 | 31 | 0.0741 | 0.0524 | 0.3871 | 8.8 | 6xu6:CF, 6xu7:CF, 6xu8:CF |