BioLiP

>protein
IIPWEERPAGCKDVLWRSVANPIIPRDLLPTSNSIFNSAVVPFGDGFAGVFRCDDTSRRMRLHVGFSKDAINWNIKEEPL
KFQCDDEEIGTWVYGYDPRVCFIEDRYYVTWCNGYHGPTIGVAYTFDFETFHQLENAFIPFNRNGVLFPRKINGRFAMLS
RPSDNGHTPFGDIFYSESPDMEFWGRHRHVMSPAAFEVSAWQCTKIGAGPIPVETPEGWLLIYHGVLHSCNGYVYSFGSA
LLDLDEPWKVKFRSGPYLLAPREPYECMGDVPNVCFPCAALHDNETGRIAIYYGCADTVTGLAFGYIPEIIEFTKRTSII

The query sequence (length=320) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4udg:B	321	320	1.0000	0.9969	1.0000	0.0	4udg:A, 4udg:C, 4udg:D, 4udg:E, 4udg:F, 4udi:A, 4udi:B, 4udi:C, 4udi:D, 4udi:E, 4udi:F, 4udj:A, 4udj:B, 4udj:C, 4udj:D, 4udj:E, 4udj:F, 4udk:A, 4udk:B, 4udk:C, 4udk:D, 4udk:E, 4udk:F
2	5aye:A	335	326	0.6562	0.6269	0.6442	3.78e-157	5aye:B, 5aye:C, 5aye:D, 5aye:E, 5aye:F
3	5b0s:B	355	252	0.2562	0.2310	0.3254	1.03e-32	5b0q:A, 5b0q:B, 5b0r:A, 5b0r:B, 5b0s:A
4	7fir:C	304	287	0.2750	0.2895	0.3066	1.30e-32	7fip:A, 7fip:B, 7fip:C, 7fip:D, 7fiq:C, 7fiq:B, 7fiq:A, 7fiq:D, 7fir:A, 7fir:B, 7fir:D, 7fis:C, 7fis:B, 7fis:A, 7fis:D
5	5ayc:A	386	308	0.2719	0.2254	0.2825	1.08e-21
6	3was:A	389	311	0.2469	0.2031	0.2540	3.54e-19	4kmi:A, 4kmi:B, 3was:B, 3wat:A, 3wat:B, 3wau:A, 3wau:B
7	5a7v:A	368	352	0.2656	0.2310	0.2415	4.87e-12	5a7v:B
8	3taw:A	349	342	0.2375	0.2178	0.2222	1.18e-07
9	3du4:A	448	31	0.0375	0.0268	0.3871	0.98	3du4:B
10	8iru:R	268	101	0.0844	0.1007	0.2673	6.2
11	3n6s:A	344	54	0.0406	0.0378	0.2407	8.5	5cky:O, 5co0:O, 5crj:O, 5crk:O, 3mva:O, 3mvb:O, 3n7q:A
12	7bkd:A	664	47	0.0500	0.0241	0.3404	8.7	7bkb:A, 7bkb:a, 7bkc:A, 7bkc:a, 7bkd:a, 7bke:A, 7bke:a

[Back]