IGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLN
KRIRYLYKHFNRHGKFR
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7a5f:i3 | 97 | 97 | 1.0000 | 1.0000 | 1.0000 | 4.17e-68 | 7a5g:i3, 7a5h:i, 7a5i:i3, 7a5j:i, 7a5k:i3, 8any:i, 6i9r:i, 3j7y:i, 3j9m:i, 8k2a:Ly, 8k2b:Ly, 7l08:i, 7l20:i, 6nu2:i, 6nu3:i, 7o9k:i, 7o9m:i, 7odr:i, 7ods:i, 7odt:i, 7of0:i, 7of2:i, 7of3:i, 7of4:i, 7of5:i, 7of6:i, 7of7:i, 7og4:i, 7oi6:i, 7oi7:i, 7oi8:i, 7oi9:i, 7oia:i, 7oib:i, 7oic:i, 7oid:i, 7oie:i, 8oir:Bz, 8oit:Bz, 5ool:i, 5oom:i, 7pd3:i, 8pk0:i, 7po4:i, 7qh6:i, 7qh7:i, 7qi4:i, 7qi5:i, 7qi6:i, 8qsj:i, 8qu5:i, 6vlz:i, 6vmi:i, 8xt0:Ly, 8xt1:Ly, 8xt2:Ly, 8xt3:Ly, 6zm5:i, 6zm6:i, 6zs9:i, 6zsa:i, 6zsb:i, 6zsc:i, 6zsd:i, 6zse:i, 6zsg:i |
2 | 5aj4:Bn | 97 | 95 | 0.8763 | 0.8763 | 0.8947 | 7.54e-61 | 6gaw:Bn, 6gb2:Bn, 7nqh:Bn, 7nql:Bn, 7nsh:Bn, 7nsi:Bn, 7nsj:Bn, 8oin:Bz, 8oiq:Bz, 6ydp:Bn, 6ydw:Bn |
3 | 8st7:A | 212 | 46 | 0.1649 | 0.0755 | 0.3478 | 6.2 | 8st7:C |
4 | 8d49:A | 1072 | 34 | 0.1443 | 0.0131 | 0.4118 | 8.0 | |
5 | 7dvq:R | 241 | 31 | 0.0928 | 0.0373 | 0.2903 | 8.3 | |
6 | 8wr4:B | 1442 | 60 | 0.1856 | 0.0125 | 0.3000 | 8.4 | |
7 | 8d4a:A | 1207 | 34 | 0.1443 | 0.0116 | 0.4118 | 9.1 | 8d4b:A |
8 | 8wmm:B | 1212 | 60 | 0.1856 | 0.0149 | 0.3000 | 9.2 | 8iyq:A, 8wmh:A, 8wmm:A, 8wmn:A, 8wmn:B, 8wr4:A |
9 | 6wqc:A | 293 | 72 | 0.1753 | 0.0580 | 0.2361 | 9.8 | 6wqb:A |