IFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITG
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vb9:c | 68 | 64 | 1.0000 | 0.9412 | 1.0000 | 1.35e-42 | 7f0l:X, 7pil:X, 7pqd:X, 7pqd:x, 7va9:C, 7va9:c, 7vb9:C, 7vnm:X, 7vny:X, 7vor:X, 7vor:x, 7vot:X, 7vot:x, 7vy2:X, 7vy2:x, 7vy3:X |
2 | 7yml:X | 65 | 59 | 0.3281 | 0.3231 | 0.3559 | 0.16 | 8b64:X |
3 | 5eiy:B | 658 | 32 | 0.2188 | 0.0213 | 0.4375 | 0.20 | 5ej1:B, 5ejz:B, 4hg6:B, 4p00:B, 4p02:B |
4 | 1ylh:A | 524 | 58 | 0.2500 | 0.0305 | 0.2759 | 0.90 | |
5 | 1os1:A | 537 | 58 | 0.2344 | 0.0279 | 0.2586 | 3.4 | 1aq2:A, 6asi:A, 6asm:A, 6asn:A, 6at2:A, 6at3:A, 6at3:B, 6at4:A, 6at4:B, 1ayl:A, 6com:A, 6crt:A, 1k3c:A, 1k3d:A, 2olq:A, 2olr:A, 2pxz:X, 2py7:X, 6v2l:A, 6v2m:A, 6v2n:A |
6 | 8yfq:R | 746 | 18 | 0.1094 | 0.0094 | 0.3889 | 3.7 | |
7 | 1xl8:B | 600 | 27 | 0.1562 | 0.0167 | 0.3704 | 8.0 | 1xl8:A |
8 | 1l5j:A | 862 | 28 | 0.1719 | 0.0128 | 0.3929 | 8.6 | 1l5j:B |
9 | 5nbp:A | 237 | 14 | 0.1562 | 0.0422 | 0.7143 | 9.1 | 7kr6:AAA, 7kr6:BBB, 5nbp:B, 6vho:AAA |