IDKITYPTRIGAVVFPHKKHQDALGECRGCHEKGPGRIDGFDKVMAHGKGCKGCHEEMKIGPVRCGDCHKGG
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3h33:A | 72 | 72 | 1.0000 | 1.0000 | 1.0000 | 1.90e-47 | |
2 | 4haj:A | 71 | 69 | 0.6250 | 0.6338 | 0.6522 | 2.50e-27 | 4hb6:A, 4hb8:A, 4hbf:A, 4hc3:A, 4hdl:A, 2ldo:A, 2lzz:A, 2mz9:A, 2n91:A, 1os6:A, 3sel:X, 3sj0:X, 3sj1:X, 3sj4:X |
3 | 3bxu:A | 71 | 69 | 0.5694 | 0.5775 | 0.5942 | 6.65e-25 | 3bxu:B |
4 | 3h34:A | 70 | 70 | 0.5139 | 0.5286 | 0.5286 | 8.08e-20 | |
5 | 3h4n:B | 69 | 68 | 0.4583 | 0.4783 | 0.4853 | 1.32e-14 | 3h4n:A |
6 | 1ehj:A | 68 | 68 | 0.4306 | 0.4559 | 0.4559 | 1.83e-12 | 1f22:A, 1hh5:A, 1kwj:A, 1l3o:A, 1lm2:A, 1new:A |
7 | 3ov0:A | 318 | 68 | 0.3750 | 0.0849 | 0.3971 | 0.010 | 3oue:A, 3ouq:A, 1rwj:A |
8 | 3ov0:A | 318 | 70 | 0.3333 | 0.0755 | 0.3429 | 0.38 | 3oue:A, 3ouq:A, 1rwj:A |
9 | 3ov0:A | 318 | 58 | 0.2639 | 0.0597 | 0.3276 | 0.67 | 3oue:A, 3ouq:A, 1rwj:A |
10 | 3cao:A | 103 | 51 | 0.2778 | 0.1942 | 0.3922 | 0.012 | 3car:A |
11 | 1z1n:X | 516 | 71 | 0.3056 | 0.0426 | 0.3099 | 0.044 | |
12 | 2e84:A | 513 | 64 | 0.2917 | 0.0409 | 0.3281 | 0.053 | |
13 | 2e84:A | 513 | 74 | 0.3056 | 0.0429 | 0.2973 | 1.7 | |
14 | 1qo8:A | 564 | 64 | 0.2639 | 0.0337 | 0.2969 | 0.10 | 1qo8:D |
15 | 1zzh:B | 308 | 40 | 0.1667 | 0.0390 | 0.3000 | 0.16 | 1zzh:A, 1zzh:C, 1zzh:D |
16 | 1aqe:A | 110 | 91 | 0.3472 | 0.2273 | 0.2747 | 0.18 | 1czj:A |
17 | 2bq4:B | 115 | 25 | 0.1667 | 0.1043 | 0.4800 | 0.37 | 2bq4:A |
18 | 1s0u:A | 391 | 67 | 0.2639 | 0.0486 | 0.2836 | 0.53 | |
19 | 1gws:A | 503 | 65 | 0.2778 | 0.0398 | 0.3077 | 0.55 | 2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D |
20 | 1gws:A | 503 | 49 | 0.2222 | 0.0318 | 0.3265 | 7.5 | 2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D |
21 | 1gws:A | 503 | 19 | 0.1250 | 0.0179 | 0.4737 | 8.9 | 2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D |
22 | 2c1v:A | 335 | 34 | 0.1528 | 0.0328 | 0.3235 | 0.79 | 2c1u:A, 2c1u:B, 2c1u:C, 2c1u:D, 2c1v:B |
23 | 1duw:A | 289 | 51 | 0.2222 | 0.0554 | 0.3137 | 5.4 | |
24 | 2ccy:A | 127 | 17 | 0.1389 | 0.0787 | 0.5882 | 6.5 | 2ccy:B |
25 | 8gy2:B | 433 | 35 | 0.1667 | 0.0277 | 0.3429 | 8.8 |