IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYT
ISLNIDCSRV
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1bwo:A | 90 | 90 | 1.0000 | 1.0000 | 1.0000 | 7.42e-62 | 1bwo:B, 1cz2:A |
2 | 3gsh:A | 91 | 90 | 0.7222 | 0.7143 | 0.7222 | 1.72e-45 | 3gsh:B, 1jtb:A, 1mid:A |
3 | 1rzl:A | 91 | 90 | 0.6111 | 0.6044 | 0.6111 | 1.20e-36 | 1uvc:A, 1uvc:B |
4 | 1fk6:A | 93 | 91 | 0.5889 | 0.5699 | 0.5824 | 2.64e-34 | 1fk7:A |
5 | 5lqv:A | 93 | 90 | 0.5556 | 0.5376 | 0.5556 | 3.39e-31 | |
6 | 6iwo:A | 92 | 90 | 0.4222 | 0.4130 | 0.4222 | 6.19e-22 | 6iwo:B, 6iwp:A, 5tvi:W, 7w9a:A |