IAHWYCGHKFRHRFMRDKRFHPSLQASHDARNRFSKRRHFKTNRWNYQQAYRDMP
The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hiv:Da | 55 | 55 | 1.0000 | 1.0000 | 1.0000 | 1.63e-36 | 6hiw:Da, 6hiy:Da, 7pua:Da, 7pub:Da |
2 | 4e51:A | 415 | 18 | 0.1636 | 0.0217 | 0.5000 | 1.3 | 4e51:B |
3 | 5xgd:A | 548 | 32 | 0.2000 | 0.0201 | 0.3438 | 1.8 | 8pps:A, 8pps:B, 5xge:A |
4 | 8esq:q | 341 | 13 | 0.1818 | 0.0293 | 0.7692 | 5.8 | |
5 | 8esr:q | 260 | 13 | 0.1818 | 0.0385 | 0.7692 | 6.2 | |
6 | 8fkt:SY | 378 | 27 | 0.2182 | 0.0317 | 0.4444 | 6.4 | 8fku:SY, 8fkv:SY, 8fkw:SY, 8fkx:SY, 8fky:SY |
7 | 2f3o:A | 773 | 20 | 0.1455 | 0.0103 | 0.4000 | 8.0 | 2f3o:B |