BioLiP

>protein
HVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHDDTEFQHPCF
LRGQEQLLENIKRKV

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7dcj:B	110	103	0.9895	0.8545	0.9126	2.62e-65	5d5u:B, 5d5v:B, 5d5v:D, 7dcj:A, 7dcs:A, 7dcs:B, 7dcs:C, 7dcs:D, 7dcs:E, 7dcs:F, 7dct:A, 7dct:B, 7dct:C, 7dct:D, 7dct:E, 7dct:F, 5hdn:A, 5hdn:C
2	7dcu:A	101	94	0.7053	0.6634	0.7128	2.59e-45	7dci:A, 7dcu:C
3	5d8k:B	106	106	0.7263	0.6509	0.6509	7.08e-45	5d8l:B, 5d8l:D, 5d8l:F, 5d8l:H, 7dcu:B
4	5d5x:B	99	97	0.4632	0.4444	0.4536	4.60e-25	5d5w:B, 5d5x:E
5	1fyk:A	88	66	0.4105	0.4432	0.5909	1.65e-23	3hts:B
6	1u2g:B	359	37	0.1158	0.0306	0.2973	2.2	2fr8:A
7	1f8g:A	382	37	0.1158	0.0288	0.2973	2.2	1f8g:B, 1f8g:C, 1f8g:D, 2frd:A, 2frd:B, 2fsv:A, 1hzz:A, 1l7e:A, 1l7e:D, 1nm5:A, 1nm5:B, 2oo5:A, 2oo5:B, 2oor:A, 2oor:B, 1ptj:A, 1u28:A, 1u28:B, 1u2d:A, 1u2d:B, 1u2g:A, 1xlt:A, 1xlt:B, 1xlt:D, 1xlt:E, 1xlt:H, 1xlt:G
8	7yni:A	566	31	0.1158	0.0194	0.3548	2.7
9	7sla:A	585	31	0.1158	0.0188	0.3548	2.7	7sl8:A
10	7wmv:A	602	31	0.1158	0.0183	0.3548	2.7
11	7oya:a1	147	46	0.1684	0.1088	0.3478	5.6	7oyb:a1
12	3ziu:A	621	50	0.1368	0.0209	0.2600	6.4	3ziu:B
13	8b9z:E	214	18	0.0842	0.0374	0.4444	7.8	8ba0:E, 8esw:V2, 8esz:V2
14	4bqa:A	132	63	0.1684	0.1212	0.2540	9.3

[Back]