HSPGQAFRAALAKENPLQIVGAINANHALLAQRAGYQAIYLSGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCPLPLL
VDADIGFGSSAFNVARTVKSIAKAGAAALHIEDQVAIVSKEEMVDRIRAAVDARTDPNFVIMARTDALAVEGLEAALDRA
QAYVDAGADMLFPEAITELSMYRRFADVAQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAFRAMNRAAEKVYTVL
RQEGTQKNVIDIMQTRNELYESINYYQF
The query sequence (length=268) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1mum:A | 289 | 279 | 0.9142 | 0.8478 | 0.8781 | 5.11e-179 | 1o5q:A, 1o5q:B, 1o5q:C, 1o5q:D, 1xg3:A, 1xg3:B, 1xg3:C, 1xg3:D |
2 | 6t4v:C | 277 | 267 | 0.7724 | 0.7473 | 0.7753 | 2.92e-154 | 6t4v:A, 6t4v:B, 6t4v:D, 6t5m:C, 6t5m:A, 6t5m:D, 6t5m:B |
3 | 4iqd:A | 290 | 273 | 0.4366 | 0.4034 | 0.4286 | 9.28e-67 | 4iqd:B |
4 | 3fa3:B | 302 | 247 | 0.3470 | 0.3079 | 0.3765 | 4.48e-38 | 3fa3:A, 3fa3:C, 3fa3:D, 3fa3:E, 3fa3:F, 3fa3:G, 3fa3:H, 3fa3:I, 3fa3:J, 3fa3:K, 3fa3:L, 3fa3:M, 3fa3:N, 3fa3:O, 3fa3:P, 3fa4:A, 3fa4:B, 3fa4:C, 3fa4:D, 3fa4:E, 3fa4:F, 3fa4:G, 3fa4:H, 3fa4:I, 3fa4:J, 3fa4:K, 3fa4:L |
5 | 1zlp:B | 285 | 261 | 0.3246 | 0.3053 | 0.3333 | 3.08e-35 | 1zlp:A |
6 | 3m0j:A | 297 | 260 | 0.3022 | 0.2727 | 0.3115 | 5.43e-27 | 3lye:A, 3m0k:A |
7 | 1m1b:A | 291 | 268 | 0.2948 | 0.2715 | 0.2948 | 5.66e-23 | 1m1b:B, 1pym:A, 1pym:B |
8 | 3b8i:A | 284 | 253 | 0.2836 | 0.2676 | 0.3004 | 3.78e-22 | 3b8i:B, 3b8i:C, 3b8i:D, 3b8i:E, 3b8i:F |
9 | 2dua:A | 283 | 272 | 0.3246 | 0.3074 | 0.3199 | 1.10e-18 | 2hjp:A |
10 | 5unc:A | 289 | 168 | 0.2239 | 0.2076 | 0.3571 | 9.96e-17 | 5unc:B, 5unc:C, 5unc:D |
11 | 2ze3:A | 275 | 193 | 0.2201 | 0.2145 | 0.3057 | 3.25e-13 | |
12 | 1igw:C | 416 | 269 | 0.2575 | 0.1659 | 0.2565 | 1.48e-11 | 1igw:B, 1igw:D |
13 | 1igw:A | 396 | 241 | 0.2500 | 0.1692 | 0.2780 | 6.05e-11 | |
14 | 7cmy:C | 417 | 300 | 0.2724 | 0.1751 | 0.2433 | 1.12e-09 | |
15 | 6lrt:A | 423 | 265 | 0.2612 | 0.1655 | 0.2642 | 3.91e-09 | 6lrt:D, 6lrt:G, 6lrt:J, 6lrt:M, 6lrt:P, 6lrt:S, 6lrt:V |
16 | 6c4a:A | 428 | 253 | 0.2537 | 0.1589 | 0.2688 | 5.85e-09 | 6c4a:B, 6c4a:C, 6c4a:D, 6c4a:E, 6c4a:F, 6c4a:G, 6c4a:H, 6c4c:A, 6c4c:B, 6c4c:C, 6c4c:D, 6c4c:E, 6c4c:F, 6c4c:G, 6c4c:H, 7cp1:A, 7cp1:B, 5dql:A, 5dql:B, 5dql:C, 5dql:D, 1f61:A, 1f61:B, 1f8i:A, 1f8i:B, 1f8i:C, 1f8i:D, 1f8m:A, 1f8m:B, 1f8m:C, 1f8m:D, 7rb1:A, 7rb1:B, 7rb1:C, 7rb1:D, 6vb9:A, 6vb9:B, 6vb9:C, 6vb9:D, 6wsi:A, 6wsi:B, 6wsi:C, 6wsi:D, 6xpp:A, 6xpp:B, 6xpp:C, 6xpp:D |
17 | 7rbx:C | 425 | 196 | 0.2201 | 0.1388 | 0.3010 | 8.02e-09 | 7rbx:A, 7rbx:B, 7rbx:D |
18 | 4lsb:B | 278 | 183 | 0.2276 | 0.2194 | 0.3333 | 2.44e-07 | 4lsb:A |
19 | 8z1r:B | 516 | 183 | 0.1754 | 0.0911 | 0.2568 | 0.002 | 8z1r:A |
20 | 7ebe:A | 544 | 113 | 0.1306 | 0.0643 | 0.3097 | 0.003 | 7ebe:B, 7ebe:C, 7ebe:D |
21 | 5e9f:D | 453 | 96 | 0.1157 | 0.0684 | 0.3229 | 0.005 | |
22 | 5e9f:B | 501 | 96 | 0.1157 | 0.0619 | 0.3229 | 0.006 | 5e9f:C, 5e9g:C |
23 | 5e9h:A | 518 | 103 | 0.1194 | 0.0618 | 0.3107 | 0.011 | |
24 | 5e9g:D | 486 | 103 | 0.1157 | 0.0638 | 0.3010 | 0.039 | |
25 | 5e9g:B | 525 | 103 | 0.1157 | 0.0590 | 0.3010 | 0.041 | 5e9f:A, 5e9g:A |
26 | 1jba:A | 189 | 71 | 0.0746 | 0.1058 | 0.2817 | 0.33 | |
27 | 6g1o:A | 486 | 82 | 0.0896 | 0.0494 | 0.2927 | 0.85 | |
28 | 3neh:A | 309 | 67 | 0.0784 | 0.0680 | 0.3134 | 2.3 | 3neh:B |
29 | 6n8e:A | 1332 | 191 | 0.1716 | 0.0345 | 0.2408 | 3.8 | |
30 | 8szu:A | 366 | 53 | 0.0709 | 0.0519 | 0.3585 | 5.3 | 8szt:B, 8szt:A, 8szt:C, 8szt:D, 8szu:B |
31 | 1xfu:A | 735 | 43 | 0.0485 | 0.0177 | 0.3023 | 8.6 | 1k90:A, 1k90:C, 1lvc:A, 1lvc:C, 1pk0:A, 1pk0:C, 1s26:A, 1s26:C, 1sk6:C, 1xfu:B, 1xfu:C, 1xfu:D, 1xfu:E, 1xfu:F, 1xfv:A, 1xfv:B, 1xfv:C, 1xfv:D, 1xfv:E, 1xfv:F, 1xfw:A, 1xfw:B, 1xfw:C, 1xfw:D, 1xfw:E, 1xfw:F, 1xfx:A, 1xfx:B, 1xfx:C, 1xfx:D, 1xfx:E, 1xfx:F, 1xfy:A, 1xfy:B, 1xfy:C, 1xfy:D, 1xfy:E, 1xfy:F, 1xfz:A, 1xfz:B, 1xfz:C, 1xfz:D, 1xfz:E, 1xfz:F, 1y0v:A, 1y0v:B, 1y0v:C, 1y0v:D, 1y0v:E, 1y0v:F |