HSEREKRVSNAVEFLLDSRVRRTPTSSKVHFLKSKGLSAEEICEAFTKVGQPKTLNEIKRILS
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6s6r:A | 69 | 63 | 1.0000 | 0.9130 | 1.0000 | 7.72e-41 | 5l87:A, 5l8a:A, 5l8a:B, 5l8a:C, 5l8a:D, 5n8v:A, 5n8v:B, 5n8v:D, 5n8v:F, 5oml:A, 5oml:D, 5oml:B, 5oml:C, 6rt2:A, 6rt2:D, 6rt2:B, 6rt2:C, 6s7m:A, 6s7m:B, 6s7m:C, 6s7m:D, 6s7m:H, 6s7m:E, 6spt:A |
2 | 7qrc:B | 61 | 59 | 0.5873 | 0.6066 | 0.6271 | 1.84e-21 | 7qrc:A |
3 | 4bxu:A | 69 | 47 | 0.3651 | 0.3333 | 0.4894 | 1.72e-09 | 2w84:A, 2w85:A |
4 | 3ff5:A | 54 | 45 | 0.3492 | 0.4074 | 0.4889 | 1.28e-08 | 3ff5:B |
5 | 3o7j:A | 166 | 37 | 0.1905 | 0.0723 | 0.3243 | 5.0 | |
6 | 2gm3:A | 153 | 21 | 0.1587 | 0.0654 | 0.4762 | 6.1 | 2gm3:B, 2gm3:C, 2gm3:D, 2gm3:E, 2gm3:F |
7 | 2oso:A | 157 | 36 | 0.2540 | 0.1019 | 0.4444 | 6.2 | 2osd:A |
8 | 5x8p:v | 190 | 31 | 0.1905 | 0.0632 | 0.3871 | 6.3 | 5mmj:v, 5mmm:v, 5x8r:v |
9 | 6ysl:E | 255 | 32 | 0.1587 | 0.0392 | 0.3125 | 8.5 | 6ysl:D, 6ysl:G, 6ysl:F, 6ysl:C |
10 | 6jq8:A | 225 | 25 | 0.1270 | 0.0356 | 0.3200 | 8.7 | |
11 | 4obv:C | 471 | 36 | 0.2222 | 0.0297 | 0.3889 | 9.0 | 4obu:E, 4obu:A, 4obu:U, 4obu:G, 4obu:H, 4obu:F, 4obu:B, 4obu:C, 4obv:D, 4obv:B, 4obv:A |