Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
HSEREKRVSNAVEFLLDSRVRRTPTSSKVHFLKSKGLSAEEICEAFTKVGQPKTLNEIKRILS

The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6s6r:A 69 63 1.0000 0.9130 1.0000 7.72e-41 5l87:A, 5l8a:A, 5l8a:B, 5l8a:C, 5l8a:D, 5n8v:A, 5n8v:B, 5n8v:D, 5n8v:F, 5oml:A, 5oml:D, 5oml:B, 5oml:C, 6rt2:A, 6rt2:D, 6rt2:B, 6rt2:C, 6s7m:A, 6s7m:B, 6s7m:C, 6s7m:D, 6s7m:H, 6s7m:E, 6spt:A
2 7qrc:B 61 59 0.5873 0.6066 0.6271 1.84e-21 7qrc:A
3 4bxu:A 69 47 0.3651 0.3333 0.4894 1.72e-09 2w84:A, 2w85:A
4 3ff5:A 54 45 0.3492 0.4074 0.4889 1.28e-08 3ff5:B
5 3o7j:A 166 37 0.1905 0.0723 0.3243 5.0
6 2gm3:A 153 21 0.1587 0.0654 0.4762 6.1 2gm3:B, 2gm3:C, 2gm3:D, 2gm3:E, 2gm3:F
7 2oso:A 157 36 0.2540 0.1019 0.4444 6.2 2osd:A
8 5x8p:v 190 31 0.1905 0.0632 0.3871 6.3 5mmj:v, 5mmm:v, 5x8r:v
9 6ysl:E 255 32 0.1587 0.0392 0.3125 8.5 6ysl:D, 6ysl:G, 6ysl:F, 6ysl:C
10 6jq8:A 225 25 0.1270 0.0356 0.3200 8.7
11 4obv:C 471 36 0.2222 0.0297 0.3889 9.0 4obu:E, 4obu:A, 4obu:U, 4obu:G, 4obu:H, 4obu:F, 4obu:B, 4obu:C, 4obv:D, 4obv:B, 4obv:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417