BioLiP

>protein
HPFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSDAKFVLHAKQNGII
RRGHNWVFKADSYESMMSWFDNLKILTSTS

The query sequence (length=110) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4a6f:B	110	113	0.9273	0.9273	0.9027	3.93e-68	4a6f:A, 4a6h:A, 4a6h:C, 4a6h:B, 4a6h:D, 4a6k:A, 4a6k:C, 4a6k:B, 4a6k:D
2	9c1w:A	388	109	0.2455	0.0696	0.2477	0.005	8q61:A
3	6hhg:A	386	97	0.2000	0.0570	0.2268	0.063	4ejn:A, 6hhf:A, 6hhh:A, 7nh4:A, 7nh5:A, 3o96:A, 6s9x:A
4	5u77:A	117	82	0.2182	0.2051	0.2927	1.4
5	6bbp:A	520	55	0.1182	0.0250	0.2364	1.5	2a5d:A, 2a5f:A, 2a5g:A, 6bbq:A, 1e0s:A, 1fgy:A, 1fhw:A, 1fhw:B, 1fhx:A, 1fhx:B, 4fme:C, 4fme:F, 2j5x:A, 2j5x:B, 4kax:A, 4kax:B, 3n5c:A, 3n5c:B, 3pcr:B, 2r09:A, 2r09:B, 2r0d:A, 2r0d:B, 3vhx:A, 3vhx:C, 3vhx:E, 3vhx:G, 2w83:A, 2w83:B, 2w83:E, 7xrd:A, 7xrd:B, 7xrd:C, 7xrd:D
6	6u3e:A	397	55	0.1182	0.0327	0.2364	1.8	6u3e:B, 6u3g:A, 6u3g:B
7	6s9w:A	411	100	0.2000	0.0535	0.2200	2.0	6buu:A, 6buu:B, 6ccy:A, 3cqu:A, 3cqw:A, 4ekk:A, 4ekk:B, 4ekl:A, 4gv1:A, 1h10:A, 6hhi:A, 6hhj:A, 3mv5:A, 3mvh:A, 6npz:A, 6npz:B, 3ocb:A, 3ocb:B, 3ow4:A, 3ow4:B, 3qkk:A, 3qkl:A, 3qkm:A, 1unq:A, 2uvm:A, 8uvy:A, 8uw2:A, 8uw7:A, 8uw9:A, 2uzs:A
8	5yb0:B	349	64	0.2000	0.0630	0.3438	5.9	5yb0:A, 5yb0:C, 5yb0:D, 5yb0:E, 5yb0:F, 5yb0:G, 5yb0:H, 5yb0:I, 5yb0:J, 5yb0:K, 5yd2:A, 5yd2:B
9	3aj4:A	112	23	0.0909	0.0893	0.4348	7.5
10	6qwo:B	253	30	0.1000	0.0435	0.3667	9.0	6qwo:A

[Back]