HNLIERRRRFNINDRIKELGTLIPKSMRWNKGTILKASVDYIRKLQREQQRAKDLEN
The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7d8t:A | 199 | 61 | 0.9825 | 0.2814 | 0.9180 | 6.35e-33 | 4ati:A, 4ati:B, 4atk:A, 4atk:B, 7d8t:B, 6g1l:A, 8vu0:A, 8vu0:B |
2 | 7f09:C | 67 | 48 | 0.7544 | 0.6418 | 0.8958 | 7.92e-25 | |
3 | 1am9:C | 82 | 54 | 0.4211 | 0.2927 | 0.4444 | 9.37e-09 | 1am9:D, 1am9:A, 1am9:B |
4 | 8ia3:E | 111 | 60 | 0.4386 | 0.2252 | 0.4167 | 1.02e-06 | 8ia3:A, 8ia3:B, 8ia3:F |
5 | 7f2f:B | 94 | 57 | 0.4211 | 0.2553 | 0.4211 | 3.36e-06 | 7f2f:A |
6 | 1an4:A | 65 | 57 | 0.4035 | 0.3538 | 0.4035 | 1.09e-05 | 1an4:B |
7 | 8osk:M | 316 | 44 | 0.3333 | 0.0601 | 0.4318 | 1.32e-05 | 4h10:B, 8osl:M, 8osl:O |
8 | 8ow1:B | 116 | 46 | 0.3509 | 0.1724 | 0.4348 | 1.12e-04 | 8ovw:A, 8ovw:B, 8ow0:A, 8ow0:B, 8ow1:A, 7ssa:L, 7ssa:K |
9 | 8hov:A | 87 | 74 | 0.3684 | 0.2414 | 0.2838 | 1.73e-04 | 8hov:C, 8hov:B, 8hov:D, 8hov:E, 8hov:F |
10 | 4zpr:A | 235 | 58 | 0.3333 | 0.0809 | 0.3276 | 0.003 | |
11 | 8osl:N | 290 | 46 | 0.2982 | 0.0586 | 0.3696 | 0.008 | 4h10:A, 8osk:N, 8osl:P |
12 | 5gnj:B | 77 | 46 | 0.2456 | 0.1818 | 0.3043 | 0.013 | 5gnj:G, 5gnj:I, 5gnj:A, 5gnj:E, 5gnj:F, 5gnj:M, 5gnj:N |
13 | 1hlo:A | 80 | 49 | 0.2632 | 0.1875 | 0.3061 | 0.016 | |
14 | 5nj8:D | 134 | 49 | 0.2982 | 0.1269 | 0.3469 | 0.017 | |
15 | 5eyo:C | 88 | 49 | 0.2632 | 0.1705 | 0.3061 | 0.018 | 1an2:A, 5eyo:A, 1hlo:B, 1nkp:B, 1nkp:E, 1nlw:B, 1nlw:E |
16 | 7xi4:A | 283 | 50 | 0.2982 | 0.0601 | 0.3400 | 0.022 | 8g4a:A, 8g4a:B, 5nj8:B, 5sy7:A, 5v0l:A, 7xhv:A, 4zph:A, 4zpk:A |
17 | 7xi3:A | 287 | 50 | 0.2807 | 0.0557 | 0.3200 | 0.028 | |
18 | 5i50:B | 96 | 58 | 0.3509 | 0.2083 | 0.3448 | 0.13 | 5i50:A, 1nkp:A, 1nkp:D |
19 | 8h1c:B | 983 | 27 | 0.1754 | 0.0102 | 0.3704 | 1.6 | 8h1c:A, 7xjz:A, 7xk0:A, 7xk1:A, 7xk1:C |
20 | 7sqc:1A | 1639 | 36 | 0.2281 | 0.0079 | 0.3611 | 4.3 | |
21 | 7sqc:1B | 1660 | 36 | 0.2281 | 0.0078 | 0.3611 | 4.3 | |
22 | 7sqc:1C | 1700 | 36 | 0.2281 | 0.0076 | 0.3611 | 4.3 | 7sqc:1D |
23 | 1nlw:A | 79 | 55 | 0.2807 | 0.2025 | 0.2909 | 4.3 | 1nlw:D |
24 | 2ypa:A | 67 | 46 | 0.2807 | 0.2388 | 0.3478 | 6.1 | 2ypb:A |
25 | 2x2t:A | 152 | 31 | 0.2105 | 0.0789 | 0.3871 | 7.5 |