HMTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTEKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMT
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jj4:B | 76 | 76 | 1.0000 | 1.0000 | 1.0000 | 5.42e-53 | 1jj4:A |
2 | 2ayb:A | 87 | 80 | 0.5263 | 0.4598 | 0.5000 | 5.80e-22 | 2ayb:B, 2ayg:A, 2ayg:B |
3 | 2bop:A | 85 | 71 | 0.2763 | 0.2471 | 0.2958 | 1.62e-06 | |
4 | 5t8s:A | 388 | 43 | 0.1711 | 0.0335 | 0.3023 | 1.1 | 5t8s:B, 5t8t:A, 5t8t:B |
5 | 7pay:A | 329 | 40 | 0.1711 | 0.0395 | 0.3250 | 1.3 | 7pax:A, 7pb0:A, 7pb1:A, 6w2l:A, 6z1n:A |
6 | 3qsz:B | 179 | 46 | 0.1579 | 0.0670 | 0.2609 | 4.2 | 3qsz:A |
7 | 3ial:B | 505 | 23 | 0.1184 | 0.0178 | 0.3913 | 5.7 | 3ial:A |
8 | 6kbn:C | 504 | 30 | 0.1579 | 0.0238 | 0.4000 | 6.4 | 6kbm:A, 6kbn:A |
9 | 5fg3:A | 598 | 55 | 0.1974 | 0.0251 | 0.2727 | 8.2 | 5yt0:A |
10 | 5ud5:A | 86 | 35 | 0.1579 | 0.1395 | 0.3429 | 9.5 | 5ud5:B, 5v6x:A, 5v6x:B |