BioLiP

>protein
HMPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQY

The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8im5:A	66	57	0.9661	0.8636	1.0000	1.67e-37	3b0a:E
2	7yui:B	232	56	0.9153	0.2328	0.9643	5.44e-35	3b08:K, 3b08:B, 3b08:E, 3b08:H, 3b0a:B
3	2crc:A	52	40	0.6271	0.7115	0.9250	8.45e-24
4	3a9j:C	32	25	0.2034	0.3750	0.4800	0.004	9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C
5	1nj3:A	31	20	0.1864	0.3548	0.5500	0.032	1q5w:A
6	2k1p:A	33	20	0.1525	0.2727	0.4500	0.85
7	7odf:A	703	20	0.1525	0.0128	0.4500	1.1
8	7dve:A	498	19	0.1695	0.0201	0.5263	2.1
9	7qbu:A	418	38	0.2373	0.0335	0.3684	2.9	7qbs:A, 7qbt:A, 7qbt:B, 7qbt:C, 7qbt:D, 7qbu:B, 7qbv:A, 7qbv:B, 7qbv:C, 7qbv:D
10	7mo1:B	34	27	0.1695	0.2941	0.3704	3.2
11	2cr8:A	53	29	0.1695	0.1887	0.3448	4.6
12	7ooc:A	249	21	0.1525	0.0361	0.4286	6.1	7p6z:A, 7pah:A, 7pai:A, 7paj:A, 7pak:A, 7pal:A, 7pam:A, 7pan:A, 7pao:A, 7paq:A, 7par:A, 7pas:A, 7ph9:A, 7pha:A, 7phb:A, 7phc:A, 7pi8:A, 7pi9:A, 7pia:A, 7pib:A, 7pic:A, 7pio:A, 7pip:A, 7piq:A, 7pir:A, 7pis:A, 7pit:A
13	4ipi:A	351	22	0.1186	0.0199	0.3182	6.7	4ipj:A, 6ppw:A, 6ppy:A, 6ppz:A, 2wqp:A, 1xuu:A, 1xuz:A
14	2b9e:A	275	15	0.1695	0.0364	0.6667	7.7
15	7mo3:B	38	29	0.2034	0.3158	0.4138	8.1	7mo3:D, 7mo4:B, 7mo4:D

[Back]