BioLiP

>protein
HMNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGIQAMVEFESVLCAQKAKAALNGADIYAGCCTLKIEYAR
PTRLNVIRNDNDSWDYTKPYL

The query sequence (length=101) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7evs:A	101	101	1.0000	1.0000	1.0000	9.01e-73	7evs:B
2	2mqp:A	118	101	0.7228	0.6186	0.7228	6.06e-54	7evr:A, 7evr:C
3	2adb:A	127	98	0.4059	0.3228	0.4184	1.82e-23	3zzy:A, 3zzy:B, 3zzz:A, 3zzz:B
4	2adc:A	208	98	0.2673	0.1298	0.2755	0.015
5	4qqb:A	169	37	0.1584	0.0947	0.4324	0.56	1b7f:A, 1b7f:B, 4qqb:B
6	6hip:A	104	45	0.1782	0.1731	0.4000	1.1	6hip:B, 5lso:A, 5lso:B, 2peh:A, 2peh:B
7	1rk8:A	87	32	0.1485	0.1724	0.4688	2.0
8	4oth:A	306	45	0.1485	0.0490	0.3333	2.3	4oti:A
9	4otg:A	324	45	0.1485	0.0463	0.3333	2.3
10	8gix:E	991	23	0.1089	0.0111	0.4783	2.9
11	6bja:A	382	31	0.1089	0.0288	0.3548	4.5
12	6m75:A	167	62	0.2079	0.1257	0.3387	4.6
13	4ttv:A	403	34	0.0891	0.0223	0.2647	6.5	4hwt:A, 4hwt:B, 4p3n:A, 4p3n:B, 4p3n:C, 4p3n:D, 4ttv:B, 4ttv:C, 4ttv:D
14	4ald:A	363	41	0.1584	0.0441	0.3902	7.1	6ald:A, 6ald:B, 3dft:A, 3dft:B, 3dft:C, 3dft:D, 3lge:A, 3lge:B, 3lge:C, 3lge:D, 2ot0:A, 2ot0:B, 2ot0:C, 2ot0:D, 2ot1:A, 2ot1:B, 2ot1:C, 2ot1:D, 2quv:A, 2quv:B, 2quv:D, 5tle:A, 5tle:B, 5tle:C, 5tle:D, 5tlh:A, 5tlh:B, 5tlh:C, 5tlh:D, 5tlw:A, 5tlw:B, 5tlw:C, 5tlw:D, 5tlz:A, 5tlz:B, 5tlz:C, 5tlz:D, 3tu9:A, 3tu9:B, 3tu9:C, 3tu9:D, 6xmh:A, 6xmh:B, 6xml:A, 6xml:B, 6xmm:A, 6xmm:B, 6xmo:A, 6xmo:B, 1zai:A, 1zai:B, 1zai:C, 1zai:D, 1zaj:A, 1zaj:B, 1zaj:C, 1zaj:D, 1zal:A, 1zal:B, 1zal:C, 1zal:D
15	5lpa:A	267	45	0.1287	0.0487	0.2889	7.4	6fzb:A, 6fzb:B, 5g4a:A, 5g4a:B, 5lpa:B, 5luh:A, 5luh:B
16	8gbj:D	308	25	0.1089	0.0357	0.4400	8.4	8faz:D, 8ouy:C, 8ouz:C

[Back]