BioLiP

>protein
HMLIRKLFKFENAHVVRKRSIHGHSYKVELLLKASKLDHGQMVYDFGLLKGVIKDLFDSFDHAICFWEKDDPQYIDACKT
FSARWISLPVSPSAEQFSRIFFYLAQQVLDVEVYSVIVHETDTGYAQSFLEDIQNEQMGLLNLEGIIFSEQVQSEWADPN
MYENLKQGI

The query sequence (length=169) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7v0f:A	182	178	1.0000	0.9286	0.9494	1.98e-121	7v0f:B
2	2oba:B	121	107	0.1598	0.2231	0.2523	6.10e-06	2oba:A, 2oba:C, 2oba:D, 2oba:E, 2oba:F
3	4ntk:A	121	103	0.1657	0.2314	0.2718	5.30e-04	4ntk:E, 4ntk:B, 4ntk:C, 4ntk:D, 4ntk:F, 4ntm:A, 4ntm:E, 4ntm:B, 4ntm:C, 4ntm:D, 4ntm:F, 4ntn:A, 4ntn:B, 4ntn:C, 4ntn:D, 4ntn:E, 4ntn:F, 3qn0:A, 3qn0:B, 3qn0:C, 3qn0:D, 3qn0:E, 3qn0:F, 3qn9:A, 3qn9:B, 3qna:A, 3qna:B, 3qna:C, 3qna:D, 3qna:E, 3qna:F
4	1y13:A	163	59	0.1124	0.1166	0.3220	0.003	1y13:C, 1y13:B
5	2a0s:A	163	60	0.1124	0.1166	0.3167	0.005	2a0s:B, 3lx3:A, 3lze:A, 3m0n:A
6	7b1s:B	466	52	0.0828	0.0300	0.2692	0.95	7b1s:E, 7b2c:B, 7b2c:E
7	2vug:A	373	59	0.0947	0.0429	0.2712	1.3	2vug:B
8	2g64:A	140	41	0.0828	0.1000	0.3415	1.8
9	6g1y:B	493	33	0.0888	0.0304	0.4545	2.6	6g1y:A, 6g1z:A, 6g1z:B, 6g20:A, 6g20:B
10	8gf5:C	429	53	0.0828	0.0326	0.2642	3.5
11	1e6y:E	433	51	0.0769	0.0300	0.2549	8.6	1e6y:B

[Back]