HMKLSELQSHIKEFDYAPEQSEHYFFKLIEEVGELSESIRKGKSGQPTLDELKGSVAEELYDVLYYVCALANIHGVNLEK
TRELKEVLNKVKY
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2q5z:B | 94 | 92 | 0.9892 | 0.9787 | 1.0000 | 5.30e-63 | 2q5z:A, 2q73:A, 2q73:B, 2q73:C, 2q73:D, 2q9l:A, 2q9l:B, 2q9l:C, 2q9l:D |
2 | 7mu5:A | 110 | 78 | 0.2688 | 0.2273 | 0.3205 | 3.37e-04 | 7mu5:E, 7mu5:B, 7mu5:H, 7mu5:C, 7mu5:D, 7mu5:F, 7mu5:G |
3 | 6sqw:A | 114 | 78 | 0.2581 | 0.2105 | 0.3077 | 0.002 | 2oig:B, 2oig:A, 2oig:D, 6sqw:D, 6sqy:A, 6sqy:D, 6sqz:A, 6sqz:D |
4 | 4qgp:A | 108 | 50 | 0.1935 | 0.1667 | 0.3600 | 0.13 | 4qgp:B |
5 | 7ody:C | 100 | 92 | 0.2796 | 0.2600 | 0.2826 | 0.17 | 7ody:A, 7ody:B, 7ody:D |
6 | 5ie9:C | 95 | 96 | 0.3011 | 0.2947 | 0.2917 | 0.21 | 5ie9:A, 5ie9:B, 5ie9:D |
7 | 4cg4:C | 376 | 36 | 0.1398 | 0.0346 | 0.3611 | 0.36 | 4cg4:D, 4cg4:E, 4cg4:F |
8 | 4po6:A | 475 | 67 | 0.2151 | 0.0421 | 0.2985 | 0.93 | |
9 | 7cdw:A | 683 | 53 | 0.2258 | 0.0307 | 0.3962 | 1.1 | 7cdw:B |
10 | 4y9d:A | 235 | 25 | 0.1290 | 0.0511 | 0.4800 | 5.8 | |
11 | 2ivn:A | 325 | 72 | 0.2366 | 0.0677 | 0.3056 | 6.3 | 2ivo:A, 2ivo:B, 2ivo:C, 2ivp:A |
12 | 4v4n:AZ | 99 | 56 | 0.1935 | 0.1818 | 0.3214 | 7.7 | 4v6u:BZ |
13 | 1ky8:A | 499 | 24 | 0.1183 | 0.0220 | 0.4583 | 8.0 | 1uxn:A, 1uxp:A, 1uxq:A, 1uxr:A, 1uxt:A, 1uxu:A, 1uxv:A |
14 | 7ulz:A | 521 | 60 | 0.2151 | 0.0384 | 0.3333 | 8.6 |