HMHKKYFIGTSILIAVFVVIFDQVTKYIIATTMKIGDSFEVIPHFLNITSHRNNGAAWGILSGKMTFFFIITIIILIALV
YFFIKDAQYNLFMQVAISLLFAGALGNFIDRVLTGEVVDFIDTNIFGYDFPIFNIADSSLTIGVILIIIALLKDT
The query sequence (length=155) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ryp:A | 164 | 155 | 1.0000 | 0.9451 | 1.0000 | 1.63e-107 | 6ryo:A |
2 | 5dir:A | 157 | 143 | 0.3032 | 0.2994 | 0.3287 | 2.93e-18 | 5dir:C, 5dir:D, 5dir:B, 6fms:A, 6fms:B, 6fms:C, 6fms:D |
3 | 2zzr:A | 397 | 48 | 0.0968 | 0.0378 | 0.3125 | 0.40 | |
4 | 7wr3:A | 794 | 43 | 0.1097 | 0.0214 | 0.3953 | 4.3 | 7wr3:B, 7wr5:A |
5 | 8iwo:A | 956 | 53 | 0.1032 | 0.0167 | 0.3019 | 5.4 | 8iwo:B, 8j2m:A, 8j2m:B |
6 | 4o2d:B | 515 | 41 | 0.0774 | 0.0233 | 0.2927 | 8.8 | |
7 | 4o2d:A | 580 | 41 | 0.0774 | 0.0207 | 0.2927 | 8.9 | 4rmf:A |