BioLiP

>protein
HMASPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIY

The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3eyi:B	67	67	1.0000	1.0000	1.0000	1.54e-46	3eyi:A, 4ka4:A, 4ka4:E, 4ka4:B, 4ka4:D
2	4kmf:A	62	56	0.2985	0.3226	0.3571	9.66e-05
3	4wcg:B	61	60	0.2687	0.2951	0.3000	0.081	4wcg:A
4	6wvj:C	1117	26	0.1791	0.0107	0.4615	0.12
5	7f75:C	1133	26	0.1791	0.0106	0.4615	0.12
6	7ckq:C	1061	26	0.1791	0.0113	0.4615	0.13
7	7zhf:A	250	53	0.2090	0.0560	0.2642	0.86	7zhk:A, 7zhk:B, 7zhk:C
8	3zqc:J	119	39	0.1940	0.1092	0.3333	2.7	3zqc:A, 3zqc:D, 3zqc:G
9	5xw2:A	375	22	0.1194	0.0213	0.3636	2.9	4e2p:A
10	3w5j:A	194	57	0.2687	0.0928	0.3158	4.5
11	2ev9:B	263	27	0.1493	0.0380	0.3704	4.9	2cy0:A, 2d5c:A, 2d5c:B, 2ev9:A
12	1h88:C	152	59	0.1940	0.0855	0.2203	6.4	1h89:C, 1h8a:C, 1mse:C, 1msf:C
13	6wmp:C	1196	60	0.2985	0.0167	0.3333	7.8	6wmr:C, 6wmt:C
14	8t6s:A	962	22	0.1493	0.0104	0.4545	8.9
15	4cmq:B	1168	22	0.1493	0.0086	0.4545	9.3	4cmp:B, 4cmq:A
16	8t78:A	863	22	0.1493	0.0116	0.4545	9.3
17	7s4u:A	1092	22	0.1493	0.0092	0.4545	9.4
18	7s37:P	1033	22	0.1493	0.0097	0.4545	9.4	7s3h:P
19	7s4v:A	1122	22	0.1493	0.0089	0.4545	9.6	6o0x:A, 8t6p:A
20	4zt9:C	1160	22	0.1493	0.0086	0.4545	9.7
21	8t76:A	1088	22	0.1493	0.0092	0.4545	9.7
22	8t6y:A	1148	22	0.1493	0.0087	0.4545	9.7	8t6o:A, 8t79:A
23	7z4d:E	1166	22	0.1493	0.0086	0.4545	9.7
24	6o0z:A	1288	22	0.1493	0.0078	0.4545	9.8
25	8t77:A	1025	22	0.1493	0.0098	0.4545	9.8
26	7z4g:B	1188	22	0.1493	0.0084	0.4545	9.8	7zo1:B
27	8t6t:A	1168	22	0.1493	0.0086	0.4545	9.9	8t7s:G
28	7z4d:B	1259	22	0.1493	0.0079	0.4545	10.0

[Back]