BioLiP

>protein
HLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLGVSSRCPICKMPLPT

The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2m1s:A	99	49	0.9592	0.4747	0.9592	3.94e-23	7ckl:B, 7ela:B, 5i72:A, 5i72:B
2	7x6v:B	48	48	0.6327	0.6458	0.6458	8.26e-17
3	7ckm:B	49	47	0.4898	0.4898	0.5106	1.31e-10	7el9:B, 7el9:E, 7elb:B, 7elb:D, 7elc:B, 7vgq:B, 7vh1:B
4	6f98:A	78	25	0.2245	0.1410	0.4400	0.56
5	2csy:A	81	35	0.2449	0.1481	0.3429	0.99
6	2ff0:A	102	47	0.3061	0.1471	0.3191	1.1	2a66:A, 5l0m:A, 8pki:K
7	6wi7:A	206	45	0.2857	0.0680	0.3111	1.8	2ckl:A, 8grm:M, 2h0d:A, 7nd1:H, 8pp7:K, 8pp7:M, 4r8p:K, 4r8p:M, 3rpg:B, 6wi8:A, 6wi8:B
8	6zu5:SDD	59	28	0.2041	0.1695	0.3571	1.9
9	7r70:A	150	21	0.1633	0.0533	0.3810	2.6	5d0i:A, 5d0i:B, 5d0k:C, 5d0k:F, 5d0k:I, 5d0k:L, 7r70:B, 7r71:A
10	7dvq:M	191	32	0.2041	0.0524	0.3125	2.6	8i0r:K, 8i0s:K, 8i0t:K, 5z56:M, 5z58:M
11	4xgc:C	567	33	0.2653	0.0229	0.3939	2.7
12	1chc:A	68	25	0.1837	0.1324	0.3600	2.9
13	6ff4:t	172	32	0.2041	0.0581	0.3125	3.6	8ch6:Z, 6ff7:t, 7qtt:Z
14	7jgs:C	614	33	0.2653	0.0212	0.3939	3.8	7jgr:C, 7jk2:C, 7jk3:C, 7jk4:C, 7jk5:C, 7jk6:C
15	1cyg:A	680	22	0.1837	0.0132	0.4091	5.3
16	7u2s:A	248	27	0.2041	0.0403	0.3704	5.6	7u2s:B
17	6l8n:A	810	37	0.2449	0.0148	0.3243	7.0
18	6ct6:B	331	25	0.2041	0.0302	0.4000	8.4	6ct6:A
19	2djb:A	72	41	0.2449	0.1667	0.2927	9.2
20	1iym:A	55	26	0.1633	0.1455	0.3077	9.8

[Back]