HIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNK
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7m5w:A | 138 | 73 | 0.9865 | 0.5290 | 1.0000 | 2.00e-52 | 6jrp:A, 6jrp:D, 6jrp:G, 6jrp:J |
2 | 1gt0:D | 79 | 70 | 0.3784 | 0.3544 | 0.4000 | 1.73e-13 | 8bx1:E, 8bx2:E, 6ht5:D, 1o4x:B, 6t90:L, 6yov:L |
3 | 4y60:C | 76 | 70 | 0.3649 | 0.3553 | 0.3857 | 2.77e-13 | |
4 | 2lef:A | 86 | 69 | 0.3378 | 0.2907 | 0.3623 | 3.38e-13 | |
5 | 6l6y:D | 80 | 70 | 0.3784 | 0.3500 | 0.4000 | 3.80e-13 | 4a3n:A, 3f27:D, 6l6y:F |
6 | 4s2q:D | 76 | 71 | 0.3514 | 0.3421 | 0.3662 | 1.30e-11 | 4euw:A |
7 | 6t78:A | 77 | 71 | 0.3649 | 0.3506 | 0.3803 | 2.97e-11 | 6t78:B, 3u2b:C |
8 | 1j5n:A | 93 | 50 | 0.2703 | 0.2151 | 0.4000 | 2.32e-07 | |
9 | 2gzk:A | 159 | 70 | 0.2973 | 0.1384 | 0.3143 | 1.06e-06 | 9bvd:C, 9bvd:F, 9bvd:I, 6cil:N, 6edb:B, 1hry:A, 1hrz:A, 1j46:A, 1j47:A, 6oem:N, 6oem:H, 6oen:N, 6oen:H, 6oeo:N, 6oer:H |
10 | 2gzk:A | 159 | 49 | 0.2297 | 0.1069 | 0.3469 | 7.77e-04 | 9bvd:C, 9bvd:F, 9bvd:I, 6cil:N, 6edb:B, 1hry:A, 1hrz:A, 1j46:A, 1j47:A, 6oem:N, 6oem:H, 6oen:N, 6oen:H, 6oeo:N, 6oer:H |
11 | 6cik:N | 90 | 38 | 0.2027 | 0.1667 | 0.3947 | 6.31e-04 | 6cg0:N, 6cim:N |
12 | 6cij:N | 133 | 38 | 0.1892 | 0.1053 | 0.3684 | 0.003 | 5zdz:N, 5ze1:N, 5ze2:N |
13 | 5jh0:D | 157 | 49 | 0.2162 | 0.1019 | 0.3265 | 0.005 | 5jgh:A, 5jgh:D, 5jgh:G, 5jgh:J, 5jh0:A |
14 | 5jh0:D | 157 | 49 | 0.1892 | 0.0892 | 0.2857 | 0.011 | 5jgh:A, 5jgh:D, 5jgh:G, 5jgh:J, 5jh0:A |
15 | 1e7j:A | 74 | 63 | 0.2297 | 0.2297 | 0.2698 | 0.030 | 3nm9:D, 3nm9:G, 3nm9:J, 3nm9:P, 3nm9:M, 3nm9:A, 1qrv:A, 1qrv:B, 8r1x:A |
16 | 4fir:A | 333 | 43 | 0.2027 | 0.0450 | 0.3488 | 0.24 | 4fir:B, 4fir:C, 4fir:D, 4fir:E, 4fir:F |
17 | 4qr9:A | 75 | 55 | 0.2162 | 0.2133 | 0.2909 | 0.25 | 4qr9:B |
18 | 2efe:A | 246 | 19 | 0.1216 | 0.0366 | 0.4737 | 2.8 | 2efe:C, 4g01:A |
19 | 6hb4:A | 197 | 51 | 0.1351 | 0.0508 | 0.1961 | 3.5 | 6erp:C, 6erp:G, 6erq:C, 6erq:G, 6hb4:D, 6hb4:G, 6hb4:J, 6hc3:A, 6hc3:D, 6hc3:G, 6hc3:J, 7lbw:A, 7lbw:B, 7lbx:A, 7lbx:B, 4nnu:A, 4nnu:B, 4nod:A, 4nod:B, 4nod:G, 4nod:H, 3tmm:A, 3tq6:A, 3tq6:B |
20 | 4mgu:A | 379 | 20 | 0.1351 | 0.0264 | 0.5000 | 6.9 | |
21 | 3lv8:A | 204 | 26 | 0.0946 | 0.0343 | 0.2692 | 6.9 | |
22 | 7p1g:M | 347 | 8 | 0.0946 | 0.0202 | 0.8750 | 6.9 | 7p1g:K, 7p1g:L, 7p1g:N, 7p1g:O |
23 | 7zie:B | 185 | 52 | 0.2432 | 0.0973 | 0.3462 | 7.2 | 7zie:A |
24 | 4c0w:A | 200 | 40 | 0.2027 | 0.0750 | 0.3750 | 10.0 | 4c0x:A, 4c14:A |