HHHSQDPMSGILYINIYPIVNYPETIKVSAIPYYEEFLPGKWKKRIGDLIYLYGYGIENEFDEIDNSNALFGKIFRKYLL
The query sequence (length=236) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8ok9:C |
236 |
236 |
1.0000 |
1.0000 |
1.0000 |
1.27e-174 |
8pvv:C, 8qg0:B |
2 |
7yf2:A |
275 |
66 |
0.0720 |
0.0618 |
0.2576 |
2.0 |
8gze:B, 8gze:A, 8gzf:A, 8gzf:B, 7y9c:A, 7y9c:B, 7yf2:B, 7yf3:A, 7yf3:B, 7yf4:A, 7yf4:B |
3 |
6pmi:F |
239 |
129 |
0.1441 |
0.1423 |
0.2636 |
2.0 |
6pmj:F |
4 |
5x51:M |
1386 |
119 |
0.1144 |
0.0195 |
0.2269 |
2.5 |
5x4z:A, 5x51:A, 8yfr:A |
5 |
5xon:A |
1427 |
119 |
0.1144 |
0.0189 |
0.2269 |
2.5 |
6a5l:A, 6a5o:A, 6a5p:A, 6a5r:A, 6a5t:A, 6a5u:A, 8h0v:A, 8h0w:A, 8he5:A, 6inq:A, 6ir9:A, 6j4w:A, 6j4x:A, 6j4y:A, 6j4z:A, 6j50:A, 6j51:A, 8jh2:A, 8jh3:A, 8jh4:A, 7wbv:A, 7wbw:A, 7wbx:A, 5x4z:M, 5x50:A, 7xn7:A, 5xog:A, 7xse:A, 7xsx:A, 7xsz:A, 7xt7:A, 7xtd:A, 7xti:A, 8yfq:A |
6 |
5odc:F |
447 |
87 |
0.0975 |
0.0515 |
0.2644 |
3.3 |
5odc:L, 5odh:F, 5odh:L, 5odi:F, 5odi:L, 5odq:F, 5odq:L, 5odr:F, 5odr:L |
7 |
6mo5:A |
303 |
63 |
0.0763 |
0.0594 |
0.2857 |
4.5 |
6c9c:A, 6cax:A, 7ci4:A, 7ci4:B, 7ci5:A, 7ci5:B, 7ci5:C, 7ci5:D, 7ci6:A, 7ci6:B, 7ci7:A, 7ci8:A, 7ci8:B, 7ci9:A, 7cia:A, 7cib:A, 7cic:A, 7cic:B, 7cid:A, 7cie:A, 7cie:B, 7del:A, 7dem:A, 7den:A, 5drq:A, 5drr:A, 6dui:A, 8e4a:A, 6e54:A, 4fw3:A, 4fw3:B, 4fw3:C, 4fw3:D, 4fw4:A, 4fw4:B, 4fw4:C, 4fw4:D, 4fw5:A, 4fw5:B, 4fw5:C, 4fw5:D, 4fw6:A, 4fw6:B, 4fw6:C, 4fw6:D, 4fw7:A, 4fw7:B, 4fw7:C, 4fw7:D, 6i46:AAA, 6i47:AAA, 6i48:AAA, 6i49:AAA, 6i49:BBB, 6i4a:AAA, 4j3d:A, 4j3d:B, 7k99:A, 7k99:C, 7k9a:A, 7k9a:C, 4lcf:A, 4lcg:A, 4lch:A, 6mae:A, 6mo4:A, 6mod:A, 6moo:A, 5n8c:A, 5n8c:B, 4okg:A, 4okg:B, 3p3e:A, 7phn:A, 7pj2:A, 7pjg:A, 7pk8:A, 7pkk:A, 7pkm:A, 7pzs:A, 7pzu:A, 7pzv:A, 7pzw:A, 7pzx:A, 7q01:A, 3u1y:A, 3u1y:B, 5u39:A, 5u3b:A, 5u3b:B, 3uhm:A, 5upg:A, 2ves:A, 2ves:B, 2ves:C, 5vwm:A |
8 |
5vh2:A |
209 |
137 |
0.1441 |
0.1627 |
0.2482 |
8.4 |
5vh2:B, 5vh2:C, 5vh2:D |