HFEIGSIVGILITFINGPTEVYGQFLDGSPPLVWDKKDVPENKRTFKSKPRLLDIVLALYSDGCFYRAQIIDEFPSEYMI
FYVDYGNTEFVPLSCLAPCENVDSFKPHRVFSFHIEGIVRSKNLTHQKTIECIEYLKSKLLNTEMNVHLVQRLPDGFLIR
FLDDWKYIPEQLLQRNYAQVS
The query sequence (length=181) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7cfd:F | 182 | 181 | 1.0000 | 0.9945 | 1.0000 | 1.11e-135 | 7cfd:B, 7cfd:A, 7cfd:C, 7cfd:E, 7cfd:G, 7cfd:H, 7cfd:D |
2 | 3omc:A | 217 | 54 | 0.1160 | 0.0968 | 0.3889 | 8.98e-05 | 5m9o:A, 3omc:B, 3omg:A, 3omg:B |
3 | 5m9n:A | 202 | 116 | 0.1823 | 0.1634 | 0.2845 | 0.005 | 5m9n:B |
4 | 5vqh:A | 213 | 115 | 0.1602 | 0.1362 | 0.2522 | 0.014 | 5vqh:B |
5 | 5ygf:A | 215 | 52 | 0.0939 | 0.0791 | 0.3269 | 0.022 | 5ygd:A |
6 | 5yj8:A | 60 | 49 | 0.1105 | 0.3333 | 0.4082 | 0.93 | 8jtn:A, 2lto:A, 6v9t:AAA, 6v9t:BBB |
7 | 6tug:B | 415 | 82 | 0.1547 | 0.0675 | 0.3415 | 1.6 | 6tug:A, 6tug:C, 6tug:D, 6tug:E, 6tug:F, 6tug:G, 6tug:H |
8 | 6go1:A | 318 | 28 | 0.0608 | 0.0346 | 0.3929 | 5.2 | 6go1:B |
9 | 5ijw:B | 276 | 25 | 0.0552 | 0.0362 | 0.4000 | 6.1 | 5ijw:A |
10 | 5hj7:B | 260 | 25 | 0.0552 | 0.0385 | 0.4000 | 6.4 | 5hj7:A |