HAFRFHHIGVQTSDLENSLGWYREFFGCEQNWSLEKFSDLTRSRLPGITRLVELAAGDLRIHVFERAPAPVAEVPQFQHL
CLATRSPEEMTEWRDRWLELYESGRYTFVRDEGPTDIVVDEDGVLSLYVLDVNGLEYEFTYLPEGV
The query sequence (length=146) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6on3:B | 148 | 148 | 0.9863 | 0.9730 | 0.9730 | 1.67e-103 | 6on1:A, 6on1:B, 6on1:C, 6on1:D, 6on1:E, 6on1:F, 6on3:A, 6on3:C, 6on3:D, 6on3:F, 6on3:E |
2 | 3sk2:A | 132 | 119 | 0.1712 | 0.1894 | 0.2101 | 1.2 | 3sk2:B |
3 | 4rlr:A | 126 | 45 | 0.0822 | 0.0952 | 0.2667 | 1.2 | |
4 | 8c6j:J | 367 | 78 | 0.1438 | 0.0572 | 0.2692 | 1.7 | 8ch6:O, 7dh6:B, 7dh6:C, 7dh6:D, 6ff4:D, 9fmd:T, 8i0p:T, 8i0r:T, 8i0t:T, 8i0w:T, 6id0:T, 6id1:T, 6qdv:J, 8ro2:T, 5xjc:T, 5yzg:T, 5z56:T, 5z57:T, 5z58:T, 6zym:D |
5 | 4k6f:B | 245 | 76 | 0.1575 | 0.0939 | 0.3026 | 1.9 | 4k6f:C, 4k6f:D |
6 | 4g56:A | 617 | 48 | 0.1096 | 0.0259 | 0.3333 | 2.9 | 4g56:C |
7 | 2xkl:A | 149 | 56 | 0.1301 | 0.1275 | 0.3393 | 4.8 | |
8 | 6qh4:C | 138 | 26 | 0.0479 | 0.0507 | 0.2692 | 5.4 | 6qh4:A, 6qh4:B, 6qh4:D, 3rmu:A, 3rmu:B, 3rmu:C, 3rmu:D |
9 | 7aoi:XA | 154 | 44 | 0.1233 | 0.1169 | 0.4091 | 6.7 | 6yxx:EG, 6yxy:EG |
10 | 5okz:Q | 207 | 42 | 0.0822 | 0.0580 | 0.2857 | 7.2 |