Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4apd:A 31 31 1.0000 1.0000 1.0000 2.74e-17 7ki0:P
2 5niq:A 39 29 0.4516 0.3590 0.4828 1.65e-05
3 6gdz:A 39 29 0.5161 0.4103 0.5517 1.03e-04 6ge2:A
4 2qkh:B 32 31 0.3871 0.3750 0.3871 0.004
5 5z2v:B 197 18 0.2903 0.0457 0.5000 5.2 5z2v:A
6 6rxu:CR 760 14 0.2581 0.0105 0.5714 5.6 6rxv:CR, 6rxx:CR, 6rxz:CR
7 7x07:A 633 24 0.3548 0.0174 0.4583 7.2 7shn:A, 7shn:B, 7vzb:A, 7vzb:B, 7x0t:A, 7x0t:B, 7x1w:A, 7x1w:B, 7xec:A, 7yrq:A, 7yrq:B
8 7x0z:B 580 24 0.3548 0.0190 0.4583 7.4 7shm:A, 7shm:B, 7x0z:A
9 8a3t:B 440 29 0.3548 0.0250 0.3793 7.5 4bh6:F, 4bh6:E, 4bh6:G, 4bh6:H
10 4xhg:A 357 28 0.3226 0.0280 0.3571 7.5 4xh0:A, 4xhl:A
11 7rr9:A 560 24 0.3548 0.0196 0.4583 7.7 7rr9:B, 7vx8:B, 7vx8:A
12 6fie:B 255 25 0.3226 0.0392 0.4000 7.8
13 5a31:R 386 29 0.3548 0.0285 0.3793 8.3
14 2pyj:B 572 20 0.2581 0.0140 0.4000 9.8 2py5:A, 2py5:B, 2pyj:A, 2pyl:A, 2pzs:A, 2pzs:B, 2pzs:C, 2pzs:D, 1xhz:A, 1xhz:B, 1xhz:C, 1xhz:D, 1xi1:A, 1xi1:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417