GYDEEKVNRIQGDLQTVDISGVSQILKAIADENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRK
EGKLALYSLGDEHIRQIMMIALAHKKE
The query sequence (length=107) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1u2w:B | 107 | 107 | 1.0000 | 1.0000 | 1.0000 | 1.42e-75 | 1u2w:A, 1u2w:C |
2 | 1u2w:D | 94 | 107 | 0.8692 | 0.9894 | 0.8692 | 7.38e-61 | |
3 | 1r23:A | 104 | 62 | 0.2430 | 0.2500 | 0.4194 | 1.51e-09 | 1r22:A, 1r22:B, 1r23:B |
4 | 6cdb:A | 97 | 93 | 0.2617 | 0.2887 | 0.3011 | 7.37e-08 | 6cda:A, 6cdb:B, 4ggg:A, 4ggg:B, 2m30:A, 2m30:B, 1r1v:A |
5 | 2jsc:B | 97 | 81 | 0.2430 | 0.2680 | 0.3210 | 3.25e-05 | 2jsc:A |
6 | 6o8m:A | 95 | 78 | 0.2430 | 0.2737 | 0.3333 | 8.55e-05 | |
7 | 4omy:A | 97 | 74 | 0.2056 | 0.2268 | 0.2973 | 1.42e-04 | 4omy:B, 4omy:C, 4omy:D, 4on0:A, 4on0:B, 4on0:C, 4on0:D |
8 | 4i2o:A | 198 | 51 | 0.1495 | 0.0808 | 0.3137 | 0.43 | 4i2o:B |
9 | 5xvn:B | 288 | 44 | 0.1495 | 0.0556 | 0.3636 | 0.47 | 5xvn:A, 5xvn:C, 5xvn:I, 5xvn:J, 5xvn:K, 5xvn:L, 5xvo:A, 5xvo:B, 5xvo:C, 5xvo:I, 5xvo:J, 5xvo:K, 5xvo:L, 5xvo:D, 5xvp:A, 5xvp:B, 5xvp:C, 5xvp:D |
10 | 6qwi:A | 448 | 73 | 0.1869 | 0.0446 | 0.2740 | 0.49 | 1bgg:B, 1bgg:C, 1bgg:D, 1e4i:A, 6qwi:B, 6r4k:A, 6r4k:B, 1uyq:A |
11 | 5xvn:D | 259 | 44 | 0.1495 | 0.0618 | 0.3636 | 0.57 | |
12 | 8pw0:A | 137 | 46 | 0.1495 | 0.1168 | 0.3478 | 0.65 | |
13 | 5knk:B | 324 | 89 | 0.2336 | 0.0772 | 0.2809 | 0.85 | |
14 | 7b0c:A | 144 | 49 | 0.1589 | 0.1181 | 0.3469 | 1.6 | 7b0c:B, 5n07:A |
15 | 7t2r:D | 447 | 27 | 0.1308 | 0.0313 | 0.5185 | 2.4 | 7t2r:I, 7t30:D, 7t30:I |
16 | 7vjq:A | 120 | 51 | 0.1495 | 0.1333 | 0.3137 | 3.0 | 7vjq:B, 8w35:A, 8w35:B |
17 | 4v6w:AJ | 181 | 56 | 0.1402 | 0.0829 | 0.2679 | 6.3 | 6xu6:AJ, 6xu7:AJ, 6xu8:AJ |
18 | 5mmi:U | 96 | 44 | 0.1215 | 0.1354 | 0.2955 | 7.0 | 6eri:AT, 5h1s:V, 5mlc:V, 5mmm:U, 4v61:BV, 5x8p:U, 5x8t:U |
19 | 6xn1:B | 333 | 53 | 0.1495 | 0.0480 | 0.3019 | 7.1 | 6xn1:A, 6xn2:B, 6xn2:A |
20 | 2nz2:A | 402 | 24 | 0.0935 | 0.0249 | 0.4167 | 7.5 | |
21 | 8ebb:A | 169 | 22 | 0.1028 | 0.0651 | 0.5000 | 8.4 | |
22 | 7lhv:A | 575 | 65 | 0.1963 | 0.0365 | 0.3231 | 8.4 | 7lhv:B |