GWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWLGRAKKIGDGGWNQFQFLFFDPNGYLYAVSKDKLYKAPPPQSD
TDNWIARATEIGSGG
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3kih:B | 95 | 95 | 1.0000 | 1.0000 | 1.0000 | 2.36e-66 | 3kih:A, 3kih:C, 3kih:D |
2 | 3kif:I | 94 | 63 | 0.5895 | 0.5957 | 0.8889 | 9.13e-37 | 3kif:A, 3kif:B, 3kif:C, 3kif:D, 3kif:E, 3kif:F, 3kif:G, 3kif:J |
3 | 3kif:I | 94 | 79 | 0.5053 | 0.5106 | 0.6076 | 3.52e-31 | 3kif:A, 3kif:B, 3kif:C, 3kif:D, 3kif:E, 3kif:F, 3kif:G, 3kif:J |
4 | 8r3b:A | 47 | 47 | 0.3684 | 0.7447 | 0.7447 | 3.25e-19 | 8r3c:A, 8r3c:B, 8r3c:E |
5 | 8r3b:A | 47 | 44 | 0.3158 | 0.6383 | 0.6818 | 7.85e-16 | 8r3c:A, 8r3c:B, 8r3c:E |
6 | 3dkp:A | 240 | 69 | 0.2000 | 0.0792 | 0.2754 | 0.091 | |
7 | 5ugr:A | 323 | 63 | 0.2000 | 0.0588 | 0.3016 | 4.8 | |
8 | 5zbl:D | 181 | 50 | 0.1579 | 0.0829 | 0.3000 | 5.1 | 5zbl:C |
9 | 1sn0:A | 118 | 49 | 0.1474 | 0.1186 | 0.2857 | 7.5 | 6gnm:D, 6gnm:C, 6gno:A, 6gno:B, 6gnr:A, 6gnr:B, 6gnw:A, 6gnw:C, 6gnw:B, 6gnw:D, 6gon:A, 6gon:C, 6gon:B, 6gon:D, 6goo:A, 6goo:B, 1sn0:B, 1sn0:D, 1sn0:C, 1sn5:C, 1sn5:B, 1sn5:D |
10 | 8g9u:P | 757 | 21 | 0.0947 | 0.0119 | 0.4286 | 10.0 |