BioLiP

>protein
GVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVHPVQGLDQRSVTLKD
LDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEKV
LLHAFDGRPSVAMEGVRAGYFFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGPEKQVRNEPWNISISAEYIAQVKG
ISVEEVIEVTTQNALKLFPKLRHLL

The query sequence (length=265) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2y1h:B	265	265	1.0000	1.0000	1.0000	0.0	2y1h:A
2	1yix:A	265	265	0.3283	0.3283	0.3283	1.80e-32	1yix:B
3	1zzm:A	259	261	0.2830	0.2896	0.2874	3.17e-26
4	4pe8:A	260	268	0.2792	0.2846	0.2761	2.63e-18	1xwy:A
5	3gg7:A	243	258	0.2453	0.2675	0.2519	7.70e-16
6	8efg:A	295	271	0.2340	0.2102	0.2288	4.55e-13
7	3rcm:A	279	255	0.2340	0.2222	0.2431	3.09e-09
8	3e2v:A	363	237	0.1811	0.1322	0.2025	0.003	3e2v:B
9	3guw:A	233	94	0.0981	0.1116	0.2766	0.011	3guw:B, 3guw:C, 3guw:D
10	1ltk:C	424	58	0.0679	0.0425	0.3103	1.3	1ltk:A, 1ltk:B
11	5diy:A	463	106	0.1094	0.0626	0.2736	3.9	5diy:B
12	3oth:A	395	128	0.1321	0.0886	0.2734	4.1	3otg:A, 3oth:B
13	2r6f:B	879	59	0.0830	0.0250	0.3729	4.7
14	2r6f:A	899	59	0.0830	0.0245	0.3729	4.9
15	3uwx:A	945	59	0.0830	0.0233	0.3729	5.2
16	8wvb:A	469	91	0.1170	0.0661	0.3407	5.4	8wvb:B, 8wvf:A, 8wvf:B
17	8gap:H	384	29	0.0377	0.0260	0.3448	5.5
18	2a06:E	196	49	0.0604	0.0816	0.3265	7.9	2a06:R, 1bcc:E, 2bcc:E, 3bcc:E, 1be3:E, 1bgy:Q, 4d6t:R, 4d6u:R, 7dkf:Q1, 2fyu:E, 5gpn:E, 5gpn:Q, 5gup:2, 5gup:4, 6haw:E, 8iog:C, 8iog:c, 5j4z:AE, 5j4z:AP, 5j7y:AE, 5j7y:AP, 5j8k:AE, 5j8k:AP, 5klv:E, 1l0l:E, 1l0n:E, 5luf:q, 6nhg:E, 5nmi:E, 1ntk:E, 1ntm:E, 1ntz:E, 1nu1:E, 7o37:E, 7o37:P, 7o3c:E, 7o3c:P, 7o3h:E, 7o3h:P, 5okd:E, 8p65:E, 8p65:R, 1pp9:R, 1pp9:E, 1ppj:R, 1ppj:E, 8pw5:E, 8pw5:P, 8pw6:E, 8pw6:P, 8pw7:E, 8pw7:P, 6q9e:f1, 6q9e:f2, 6qbx:f1, 6qbx:f2, 6qc2:f1, 6qc2:f2, 6qc3:f1, 6qc3:f2, 6qc4:f1, 6qc4:f2, 7r3v:E, 1rie:A, 1sqb:E, 1sqp:E, 1sqq:E, 1sqv:E, 1sqx:E, 7tay:E, 7tz6:E, 7tz6:R, 8ugd:3E, 8ugd:3R, 8uge:3E, 8uge:3R, 8ugf:3E, 8ugf:3R, 8ugg:3E, 8ugg:3R, 8ugh:3E, 8ugh:3R, 8ugi:3E, 8ugi:3R, 8ugj:3E, 8ugj:3R, 8ugk:3E, 8ugk:3R, 8ugn:3E, 8ugn:3R, 8ugr:3E, 8ugr:3R, 8ugr:6E, 8ugr:6R, 5xte:C, 5xte:P, 5xth:AC, 5xth:AP, 5xti:AC, 5xti:AP, 6xvf:E, 2ybb:e, 2ybb:E, 6zfs:E, 6zft:E, 6zfu:E
19	7qei:A	291	67	0.0868	0.0790	0.3433	7.9
20	2vun:A	385	112	0.0981	0.0675	0.2321	9.1	2vun:B, 2vun:C, 2vun:D
21	6yje:A	416	56	0.0642	0.0409	0.3036	9.7	6yjf:A

[Back]