BioLiP

>protein
GTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEE

The query sequence (length=45) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5olm:B	132	44	0.9778	0.3333	1.0000	1.17e-27	5jpx:A, 5olm:A
2	2yrg:A	59	42	0.4667	0.3559	0.5000	3.50e-11
3	4tn3:B	362	45	0.4667	0.0580	0.4667	3.86e-11	5k3q:A, 5k3q:B, 5k3q:C, 5k3q:D, 4tn3:A, 5w9a:A, 5w9a:B
4	5va4:A	123	39	0.4444	0.1626	0.5128	5.28e-10
5	5eiu:A	134	39	0.4444	0.1493	0.5128	9.14e-10	5eiu:D, 5f7t:E, 5f7t:F, 5f7t:H, 5f7t:L, 5iea:A, 5iea:B, 5iea:C, 5iea:D, 5iea:F, 5iea:K
6	2egm:A	57	37	0.4444	0.3509	0.5405	4.32e-09
7	2did:A	53	38	0.4222	0.3585	0.5000	6.71e-08	2dif:A
8	1fre:A	39	39	0.3778	0.4359	0.4359	1.14e-07
9	2csv:A	72	41	0.2889	0.1806	0.3171	2.82e-05
10	7xyz:B	456	41	0.3556	0.0351	0.3902	5.05e-04	7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D
11	7xt2:B	388	39	0.3333	0.0387	0.3846	0.002	7xt2:A
12	2dja:A	84	44	0.2889	0.1548	0.2955	0.006
13	2jun:A	101	34	0.2444	0.1089	0.3235	0.014	2dq5:A
14	6nlx:C	335	19	0.1778	0.0239	0.4211	0.49	6nlx:B, 6nlx:D, 5ur0:A, 5ur0:B, 5ur0:C, 5ur0:D
15	7e0d:A	604	38	0.2222	0.0166	0.2632	6.7	7e0c:A, 2e1m:A, 2e1m:B, 2e1m:C, 8jpw:A
16	4zgn:A	279	16	0.1778	0.0287	0.5000	7.1	4zgp:A
17	7pub:CI	427	27	0.2000	0.0211	0.3333	9.6	6hiv:CI, 6hiw:CI, 7pua:CI, 6sg9:CI, 6sgb:CI
18	6yxy:BX	133	20	0.2444	0.0827	0.5500	9.7	7aoi:BX, 6hiv:BX, 6hix:BX

[Back]