GTENLSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLR
ILLLS
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2c60:A | 85 | 85 | 1.0000 | 1.0000 | 1.0000 | 4.54e-58 | |
2 | 7y4i:A | 822 | 27 | 0.1294 | 0.0134 | 0.4074 | 1.1 | 8dti:A, 8dti:B |
3 | 5xxb:O | 158 | 31 | 0.1412 | 0.0759 | 0.3871 | 2.6 | |
4 | 8bot:A | 3528 | 23 | 0.1529 | 0.0037 | 0.5652 | 4.3 | |
5 | 7nfc:A | 3562 | 23 | 0.1529 | 0.0036 | 0.5652 | 4.3 | 8bh3:S, 8bh3:A, 8bhv:A, 8bhv:F, 8bhy:A, 8bhy:S, 8bot:F, 8bot:S, 7nfc:F |
6 | 7nfe:A | 3585 | 23 | 0.1529 | 0.0036 | 0.5652 | 4.3 | |
7 | 7sgl:A | 3852 | 23 | 0.1529 | 0.0034 | 0.5652 | 4.3 | |
8 | 8ezb:C | 3724 | 23 | 0.1529 | 0.0035 | 0.5652 | 4.3 | 8ezb:L |
9 | 7sud:A | 3740 | 23 | 0.1529 | 0.0035 | 0.5652 | 4.5 | |
10 | 7su3:A | 3802 | 23 | 0.1529 | 0.0034 | 0.5652 | 4.5 | |
11 | 7k1j:A | 3584 | 23 | 0.1529 | 0.0036 | 0.5652 | 4.5 | 7k19:A |
12 | 7k1k:A | 3604 | 23 | 0.1529 | 0.0036 | 0.5652 | 4.5 | 7k1b:A |
13 | 8eza:L | 3720 | 23 | 0.1529 | 0.0035 | 0.5652 | 4.5 | 8eza:C, 7lt3:C, 7lt3:L |
14 | 6zhe:A | 3768 | 23 | 0.1529 | 0.0035 | 0.5652 | 4.5 | |
15 | 7k1n:A | 3634 | 23 | 0.1529 | 0.0036 | 0.5652 | 4.6 | 7z88:A |
16 | 6zhe:F | 3731 | 23 | 0.1529 | 0.0035 | 0.5652 | 4.6 | |
17 | 7k0y:A | 3669 | 23 | 0.1529 | 0.0035 | 0.5652 | 4.6 | |
18 | 6zha:A | 3707 | 23 | 0.1529 | 0.0035 | 0.5652 | 4.6 | 6zh8:A |
19 | 5y3r:C | 3636 | 23 | 0.1529 | 0.0036 | 0.5652 | 4.6 | |
20 | 7k17:B | 3645 | 23 | 0.1529 | 0.0036 | 0.5652 | 4.6 | 7k17:A |
21 | 8ez9:L | 3662 | 23 | 0.1529 | 0.0035 | 0.5652 | 4.6 | 8ez9:C |
22 | 7z87:A | 3689 | 23 | 0.1529 | 0.0035 | 0.5652 | 4.6 | |
23 | 7otm:A | 3656 | 23 | 0.1529 | 0.0036 | 0.5652 | 4.7 | 7otp:A, 7otv:A, 7otw:A, 7oty:A |
24 | 6oif:A | 282 | 38 | 0.1294 | 0.0390 | 0.2895 | 6.2 | 5j1s:A, 5j1t:A, 6oif:C, 6oif:B, 6oif:E, 6oif:D, 6oif:G, 6oif:F, 6oif:I, 6oif:H, 6oif:K, 6oif:J, 6oif:M, 6oif:L, 6oif:O, 6oif:N, 6oif:Q, 6oif:P, 6oif:S, 6oif:R, 6oif:U, 6oif:T, 6oif:W, 6oif:V, 6oif:Y, 6oif:X |
25 | 5faw:B | 806 | 46 | 0.1529 | 0.0161 | 0.2826 | 7.4 | 5fau:A, 5fau:B, 5fau:C, 5fau:D, 5faw:A, 5fay:A, 5fay:B, 6nd3:A, 6nd3:B, 6nd3:C, 6nd3:D, 6nd3:E, 6nd3:F, 6nd3:G, 6nd3:H, 6vue:A, 6vue:B |
26 | 3kkz:A | 256 | 34 | 0.1176 | 0.0391 | 0.2941 | 7.7 | 3kkz:B |
27 | 7n8o:U | 95 | 61 | 0.2235 | 0.2000 | 0.3115 | 9.4 | 7n8o:u, 7rcv:U, 7rcv:u, 8tow:U, 8tow:u |
28 | 7kaw:C | 593 | 23 | 0.1294 | 0.0185 | 0.4783 | 9.5 | 7kaw:B, 7kaz:C, 7kaz:B |