BioLiP

>protein
GSSGSSGSSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPG

The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2ebv:A	57	57	1.0000	1.0000	1.0000	6.86e-35
2	7mo3:B	38	37	0.5439	0.8158	0.8378	1.17e-18	7mo3:D, 7mo4:B, 7mo4:D
3	7mo2:B	38	37	0.3684	0.5526	0.5676	4.05e-10	3ch5:B, 7mo2:D
4	7mo5:B	36	34	0.3509	0.5556	0.5882	6.85e-10
5	7mnv:B	38	37	0.3333	0.5000	0.5135	5.89e-06
6	7mnt:B	38	39	0.2982	0.4474	0.4359	1.34e-05	7mnt:D, 7mnu:B
7	7mns:B	38	35	0.2632	0.3947	0.4286	1.74e-05
8	2ebq:A	47	29	0.2632	0.3191	0.5172	2.14e-05	2gqe:A, 2k0c:A
9	2ebr:A	47	26	0.2281	0.2766	0.5000	1.26e-04
10	7mo1:B	34	25	0.1930	0.3235	0.4400	0.001
11	7mnr:B	40	39	0.2281	0.3250	0.3333	0.002
12	7mnp:B	39	26	0.1754	0.2564	0.3846	0.017	7mnp:D, 7mnq:B
13	2d9g:A	53	26	0.2281	0.2453	0.5000	0.018
14	8pp6:K	36	26	0.2281	0.3611	0.5000	0.11
15	4a1g:B	149	20	0.1404	0.0537	0.4000	2.6	4a1g:A, 4a1g:C, 4a1g:D
16	7pcv:A	116	30	0.1930	0.0948	0.3667	3.5	2lk0:A, 2lk1:A, 7pcv:B, 7pdv:E, 7pdv:A, 7pdv:C, 7pdv:G
17	6fah:E	393	26	0.2105	0.0305	0.4615	5.2	6fah:A
18	1e3p:A	645	30	0.1930	0.0171	0.3667	5.8
19	7ld5:A	587	30	0.1930	0.0187	0.3667	5.9	7ld5:B, 7ld5:C
20	8wx0:A	597	30	0.1930	0.0184	0.3667	5.9	8wx0:B, 8wx0:C
21	1e8e:A	124	29	0.1930	0.0887	0.3793	8.0	1gu2:A, 1gu2:B, 1oae:A, 1oae:B
22	2czs:A	70	13	0.1404	0.1143	0.6154	8.1	2czs:B
23	3o0h:B	459	16	0.1404	0.0174	0.5000	9.1	3o0h:A
24	5k61:A	431	21	0.1754	0.0232	0.4762	9.6	5b62:A, 5k60:A, 5k62:A, 5k63:A, 5k66:A
25	3chv:A	279	11	0.1053	0.0215	0.5455	9.9

[Back]