BioLiP

>protein
GSSGSSGQHQEAGAGDLCALCGEHLYVLERLCVNGHFFHRSCFRCHTCEATLWPGGYEQHPGDGHFYCLQHLPQTDSGPS
SG

The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2co8:A	82	82	1.0000	1.0000	1.0000	2.77e-56
2	8y6k:A	741	59	0.7195	0.0796	1.0000	2.93e-39	2bra:A, 2bra:B, 2bry:A, 2bry:B, 2c4c:A, 2c4c:B, 4txi:A, 4txk:A
3	2d8y:A	91	93	0.4634	0.4176	0.4086	2.74e-12
4	2lzu:A	72	64	0.2927	0.3333	0.3750	6.07e-07
5	2cu8:A	76	67	0.3049	0.3289	0.3731	1.03e-06
6	1b8t:A	192	64	0.2683	0.1146	0.3438	3.31e-06	1ctl:A
7	1b8t:A	192	40	0.1829	0.0781	0.3750	8.48e-04	1ctl:A
8	2dj7:A	80	83	0.4024	0.4125	0.3976	3.17e-05
9	1iml:A	76	51	0.2317	0.2500	0.3725	3.19e-05
10	1x63:A	82	84	0.3293	0.3293	0.3214	1.01e-04
11	1cxx:A	59	54	0.1951	0.2712	0.2963	2.33e-04	1ibi:A, 1qli:A
12	2o13:A	58	51	0.2073	0.2931	0.3333	3.71e-04
13	2d8x:A	70	83	0.3659	0.4286	0.3614	6.03e-04
14	1v6g:A	81	82	0.3415	0.3457	0.3415	6.86e-04
15	2ep4:A	74	45	0.2439	0.2703	0.4444	7.17e-04
16	1x64:A	89	92	0.4024	0.3708	0.3587	7.47e-04
17	1a7i:A	60	53	0.2195	0.3000	0.3396	0.009
18	2egp:A	79	73	0.3415	0.3544	0.3836	0.012
19	1x4k:A	72	84	0.3293	0.3750	0.3214	0.012
20	2o10:A	60	54	0.2073	0.2833	0.3148	0.016
21	2ect:A	78	45	0.2317	0.2436	0.4222	0.031
22	2mbv:A	96	62	0.2317	0.1979	0.3065	0.034
23	2dfy:X	158	57	0.2195	0.1139	0.3158	0.046	2dfy:C, 1rut:X
24	2dfy:X	158	51	0.1707	0.0886	0.2745	2.0	2dfy:C, 1rut:X
25	2cor:A	79	84	0.3537	0.3671	0.3452	0.050
26	2ehe:A	82	84	0.3293	0.3293	0.3214	0.11
27	2cur:A	69	45	0.1951	0.2319	0.3556	0.21
28	2cuq:A	80	83	0.3415	0.3500	0.3373	0.21
29	2lxh:C	58	49	0.2073	0.2931	0.3469	0.32	2lxp:C
30	3llx:A	373	32	0.1707	0.0375	0.4375	0.35
31	1x61:A	72	48	0.2195	0.2500	0.3750	0.51
32	1zfo:A	30	26	0.1220	0.3333	0.3846	0.75
33	6yxy:BX	133	35	0.1585	0.0977	0.3714	1.0	7aoi:BX, 6hiv:BX, 6hix:BX
34	1m3v:A	122	51	0.1707	0.1148	0.2745	1.2
35	8cli:B	689	39	0.1463	0.0174	0.3077	1.2	8clj:B, 8clj:G, 8cll:B, 8cll:G
36	2l4z:A	121	51	0.1707	0.1157	0.2745	1.3
37	1wyh:A	72	55	0.2439	0.2778	0.3636	1.4
38	4jcj:C	150	33	0.1463	0.0800	0.3636	1.8	4jcj:A, 4jcj:B
39	4lad:B	69	29	0.1463	0.1739	0.4138	3.0
40	1x62:A	79	44	0.1829	0.1899	0.3409	3.8
41	2lxd:A	123	35	0.1341	0.0894	0.3143	4.1	2l6y:B, 2l6z:C
42	1wil:A	89	48	0.2073	0.1910	0.3542	5.8	5xht:A
43	2h0v:A	335	37	0.1463	0.0358	0.3243	6.3	2h0v:B, 8hfb:A, 8hfb:B, 1y3t:A, 1y3t:B
44	6a3z:A	56	32	0.1098	0.1607	0.2812	7.5
45	7aih:Ax	167	20	0.0976	0.0479	0.4000	7.5	7am2:Ax, 7ane:Ax
46	6ww7:A	927	19	0.0976	0.0086	0.4211	8.0
47	4kfz:B	148	39	0.1463	0.0811	0.3077	8.3	4kfz:A, 2xjy:A, 2xjz:A, 2xjz:B, 2xjz:C, 2xjz:D, 2xjz:E, 2ypa:C
48	2egq:A	77	56	0.2073	0.2208	0.3036	8.5
49	2ecj:A	58	44	0.1951	0.2759	0.3636	9.2
50	1wig:A	73	60	0.2561	0.2877	0.3500	9.2

[Back]