GSSGSSGMAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDG
FSELRWDDQQKVKKTAEAGGSGPSSG
The query sequence (length=106) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2dmj:A | 106 | 106 | 1.0000 | 1.0000 | 1.0000 | 1.59e-75 | |
2 | 2n8a:A | 214 | 93 | 0.8774 | 0.4346 | 1.0000 | 2.34e-66 | 4av1:D, 4av1:B, 2l30:A, 2l31:A, 3od8:D, 3od8:F, 3oda:D, 3oda:F, 3odc:A, 3odc:B, 3ode:A, 3ode:B, 7s81:N, 7s81:A |
3 | 2n8a:A | 214 | 100 | 0.3113 | 0.1542 | 0.3300 | 3.04e-09 | 4av1:D, 4av1:B, 2l30:A, 2l31:A, 3od8:D, 3od8:F, 3oda:D, 3oda:F, 3odc:A, 3odc:B, 3ode:A, 3ode:B, 7s81:N, 7s81:A |
4 | 8g0h:C | 227 | 89 | 0.8396 | 0.3921 | 1.0000 | 3.02e-63 | 4av1:A, 4av1:C, 4dqy:D, 4dqy:A, 4dqy:B, 4dqy:E, 8g0h:A, 2jvn:A, 3od8:A, 3od8:B, 3od8:C, 3od8:E, 3od8:G, 3od8:H, 3oda:A, 3oda:B, 3oda:C, 3oda:E, 3oda:G, 3oda:H, 4opx:D, 4opx:A, 4oqa:D, 4oqa:A, 4oqb:D, 4oqb:A, 2riq:A, 7s68:A, 7s6h:C, 7s6h:A, 7s6m:A, 7s6m:C, 7s81:I, 7s81:F, 7s81:G, 7s81:O, 7s81:J, 7s81:B |
5 | 1v9x:A | 114 | 100 | 0.4528 | 0.4211 | 0.4800 | 5.11e-25 | |
6 | 2cs2:A | 134 | 92 | 0.2925 | 0.2313 | 0.3370 | 2.01e-09 | |
7 | 1uw0:A | 117 | 80 | 0.2358 | 0.2137 | 0.3125 | 2.34e-09 | |
8 | 8ova:A1 | 262 | 76 | 0.1887 | 0.0763 | 0.2632 | 0.43 | 8ove:A1, 4v8m:A1 |
9 | 2yes:B | 186 | 57 | 0.1604 | 0.0914 | 0.2982 | 2.5 | 2yes:A |
10 | 3pih:A | 836 | 24 | 0.0943 | 0.0120 | 0.4167 | 3.2 | |
11 | 7sci:A | 487 | 76 | 0.2170 | 0.0472 | 0.3026 | 4.1 | 7yx8:A, 7yx8:B |
12 | 7jx0:A | 801 | 28 | 0.0943 | 0.0125 | 0.3571 | 5.7 | 3qjz:A |
13 | 3zw3:A | 831 | 28 | 0.0943 | 0.0120 | 0.3571 | 5.8 | 2a4z:A, 4fhj:A, 4fhk:A, 6fh5:A, 6gq7:A, 4hvb:A, 5jha:A, 5jhb:A, 7jwe:A, 4kzc:A, 3lj3:A, 3mjw:A, 3nzu:A, 3p2b:A, 3qk0:A, 3sd5:A, 5t23:A, 6t3b:A, 6t3c:A, 4wwo:A, 4wwp:A, 6xrm:A, 6xrn:A, 3zvv:A |
14 | 1v87:A | 114 | 75 | 0.1981 | 0.1842 | 0.2800 | 9.9 |