BioLiP

>protein
GSSGSSGKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALV

The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2eod:A	66	66	1.0000	1.0000	1.0000	2.20e-45
2	7l3l:A	141	46	0.2576	0.1206	0.3696	0.016	7l3l:C
3	2eoi:A	44	24	0.1818	0.2727	0.5000	0.090
4	2epy:A	42	24	0.1818	0.2857	0.5000	0.094
5	2yuc:A	76	25	0.1667	0.1447	0.4400	0.21
6	2yuc:A	76	27	0.1364	0.1184	0.3333	5.8
7	2em1:A	44	24	0.1818	0.2727	0.5000	0.36
8	2eok:A	42	24	0.1818	0.2857	0.5000	0.53
9	2emv:A	44	26	0.1970	0.2955	0.5000	0.60
10	2eqw:A	42	21	0.1818	0.2857	0.5714	0.69
11	2csh:A	110	61	0.3333	0.2000	0.3607	0.70
12	2ept:A	41	20	0.1818	0.2927	0.6000	1.1
13	2eol:A	42	20	0.1818	0.2857	0.6000	2.0
14	2emw:A	44	20	0.1667	0.2500	0.5500	3.3
15	1wfe:A	86	38	0.1667	0.1279	0.2895	3.5
16	2emz:A	46	23	0.1667	0.2391	0.4783	4.6
17	2yrh:A	44	20	0.1818	0.2727	0.6000	4.7
18	4lv7:A	390	33	0.1970	0.0333	0.3939	5.7	3uds:A, 3uds:B
19	2en0:A	42	24	0.1667	0.2619	0.4583	6.1
20	3szm:C	191	29	0.1364	0.0471	0.3103	6.5	3shv:A, 3shv:B, 3szm:A, 3szm:B, 3szm:D, 3szm:E, 3szm:F, 3szm:G, 3szm:H, 3t1n:A, 3t1n:B, 3u3z:A
21	5ah5:A	789	30	0.1818	0.0152	0.4000	7.3	5ah5:B
22	1c9k:B	180	29	0.1515	0.0556	0.3448	7.5	1c9k:A, 1c9k:C
23	5t57:A	276	21	0.1212	0.0290	0.3810	8.9
24	2yta:A	41	20	0.1667	0.2683	0.5500	9.7

[Back]