GSPWRLLGALCLQRPPVVSKPLTPLQEEMASLLQQIEIERSLYSDHELRALDENQRLAKKQDILLAQDLEDMWEQKFLQF
KLGARITEADEKNDRTSLNRKLDRNLVLLVREKFGDQDVWILPQAEWQPGETLRGTAERTLATLSENNMEAKFLGNAPCG
HYTFKFPQAMRTESNLGAKVFFFKALLLTGDFSQAGNKGHHVWVTKDELGDYLKPKYLAQVRRFVSDL
The query sequence (length=228) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8any:e | 238 | 238 | 1.0000 | 0.9580 | 0.9580 | 7.63e-168 | 3j7y:e, 7odr:e, 7ods:e, 7odt:e, 8oir:Bv, 8oit:Bv, 8pk0:e, 7po4:e, 7qi4:e, 7qi5:e, 7qi6:e, 8qsj:e, 6zm5:e, 6zm6:e |
2 | 6nu2:e | 217 | 227 | 0.9386 | 0.9862 | 0.9427 | 2.88e-154 | |
3 | 8oin:Bv | 238 | 238 | 0.8816 | 0.8445 | 0.8445 | 7.59e-150 | 7nsj:Bj, 8oiq:Bv |
4 | 6gaw:Bj | 217 | 227 | 0.8377 | 0.8802 | 0.8414 | 5.56e-139 | 6gb2:Bj, 7nqh:Bj, 7nql:Bj, 7nsh:Bj, 7nsi:Bj, 6ydp:Bj, 6ydw:Bj |
5 | 7of0:e | 197 | 227 | 0.8640 | 1.0000 | 0.8678 | 5.62e-139 | 7of3:e, 7of5:e, 7of7:e |
6 | 6ywe:6 | 273 | 141 | 0.2018 | 0.1685 | 0.3262 | 1.93e-12 | 6yws:6, 6ywv:6, 6ywx:6, 6ywy:6 |
7 | 5mrc:6 | 234 | 144 | 0.1974 | 0.1923 | 0.3125 | 2.22e-09 | 5mre:6, 5mrf:6 |
8 | 3j6b:6 | 209 | 144 | 0.1930 | 0.2105 | 0.3056 | 5.06e-06 | |
9 | 5gg6:B | 295 | 121 | 0.1447 | 0.1119 | 0.2727 | 0.030 | 5gg6:A, 5gg7:A, 5gg7:B, 5gg8:A, 5gg9:A, 5gga:A, 5ggb:A, 5ggc:A, 5ggc:B, 5ggd:A, 5ggd:B, 6m65:A, 6m69:A, 6m6y:A, 6m72:A, 5xd1:A, 5xd2:A, 5xd3:A, 5xd4:A, 5xd5:B, 5xd5:A |
10 | 1jkn:A | 165 | 130 | 0.1579 | 0.2182 | 0.2769 | 0.10 | |
11 | 5dl7:A | 402 | 84 | 0.1009 | 0.0572 | 0.2738 | 0.86 | |
12 | 7ysf:A | 113 | 50 | 0.0746 | 0.1504 | 0.3400 | 1.2 | |
13 | 8c8v:A | 1032 | 34 | 0.0570 | 0.0126 | 0.3824 | 5.0 | 8c8u:A, 8c8w:A, 8c9d:A |
14 | 7nqf:B | 219 | 33 | 0.0482 | 0.0502 | 0.3333 | 6.9 | 7nqe:A, 7nqf:A, 7p9j:B, 7p9j:A, 7p9j:C, 7qaz:B, 7qaz:A, 7qaz:C |
15 | 8wi0:A | 1220 | 50 | 0.0789 | 0.0148 | 0.3600 | 8.3 | 8kci:A, 8wi2:A, 8wi5:A |
16 | 3urh:B | 465 | 54 | 0.0658 | 0.0323 | 0.2778 | 8.7 | 3urh:A |
17 | 1vc8:A | 126 | 35 | 0.0570 | 0.1032 | 0.3714 | 9.2 | 1vc8:B, 1vc9:A, 1vc9:B |