GSMLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDSTQLTSLKLELTSLIDEEKDSLRIYRLGNNYKTK
VEHIGAKPSIDLEDPLIF
The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8d3p:E | 100 | 98 | 1.0000 | 0.9800 | 1.0000 | 1.96e-69 | 8d3l:F, 8d3l:E, 8d3m:F, 8d3m:E, 8d3p:F, 8d3q:F, 8d3q:E |
2 | 7cr8:M | 93 | 74 | 0.2755 | 0.2903 | 0.3649 | 1.53e-08 | 7cr6:E, 7cr6:F, 7cr8:N, 7cr8:U, 7cr8:V, 7cr8:e, 7cr8:f, 7cr8:m, 7cr8:n, 7cr8:u, 7cr8:v, 7cr8:E, 7cr8:F |
3 | 2ik0:B | 286 | 66 | 0.2041 | 0.0699 | 0.3030 | 0.23 | 117e:A, 117e:B, 1e6a:A, 1e6a:B, 1e9g:A, 1e9g:B, 1huj:A, 1huj:B, 1huk:A, 1huk:B, 2ihp:A, 2ihp:B, 2ik0:A, 2ik1:A, 2ik1:B, 2ik2:A, 2ik2:B, 2ik4:A, 2ik4:B, 2ik6:A, 2ik6:B, 2ik7:A, 2ik7:B, 2ik9:A, 1m38:A, 1m38:B, 8prk:A, 8prk:B, 1wgi:A, 1wgi:B, 1wgj:A, 1wgj:B, 1ypp:A, 1ypp:B |
4 | 2b7j:A | 158 | 38 | 0.1224 | 0.0759 | 0.3158 | 2.8 | 2b7j:C |
5 | 1cen:A | 334 | 52 | 0.1837 | 0.0539 | 0.3462 | 3.0 | |
6 | 6ck7:A | 172 | 62 | 0.1531 | 0.0872 | 0.2419 | 3.1 | 6ck7:B, 6ck7:C, 6ck7:D |
7 | 6zpi:C | 332 | 69 | 0.1735 | 0.0512 | 0.2464 | 5.8 | 4bn2:A, 4bn2:B, 6zph:B |
8 | 1i7l:A | 309 | 57 | 0.1837 | 0.0583 | 0.3158 | 6.6 | 1i7l:B |
9 | 7unv:I | 118 | 52 | 0.1429 | 0.1186 | 0.2692 | 6.7 | 7unr:I, 7unu:I, 7unw:I |
10 | 5de3:A | 166 | 58 | 0.1633 | 0.0964 | 0.2759 | 9.1 | 5di3:A |