BioLiP

>protein
GSMKKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGREYIVDLIPKVKIELVVKEEDVDNVIDIIC
ENARTGNPGDGKIFVIPVERVVRVRTKEEGKEALLE

The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2j9e:B	119	116	1.0000	0.9748	1.0000	8.39e-77	2j9c:A, 2j9c:C, 2j9c:B, 2j9d:C, 2j9d:E, 2j9d:F, 2j9d:I, 2j9d:J, 2j9d:L, 2j9e:A, 2j9e:C, 7p52:A
2	2j9d:B	103	116	0.8879	1.0000	0.8879	4.89e-63	2j9d:H, 2j9d:K
3	7p50:A	121	112	0.7845	0.7521	0.8125	7.53e-62	7p50:B, 7p50:C
4	7p4v:A	113	113	0.7759	0.7965	0.7965	3.16e-60
5	3ncr:C	116	112	0.5603	0.5603	0.5804	1.66e-39	3ncq:A, 3ncq:B, 3ncq:C, 3ncr:A, 3ncr:B
6	3n5b:A	112	112	0.5862	0.6071	0.6071	4.16e-39	8wm7:E
7	2xbp:A	113	112	0.5690	0.5841	0.5893	1.03e-38	4aff:A, 4c3k:C, 4c3k:F, 2xul:A, 2xul:B, 2xul:C, 2xul:D, 2xul:E, 2xul:F, 2xzw:A, 2xzw:B, 2xzw:C, 2xzw:D, 2xzw:F, 2xzw:G, 2xzw:H, 2xzw:I
8	3ta1:D	115	107	0.5603	0.5652	0.6075	1.85e-38	3ta1:A, 3ta1:C, 3ta1:B, 3ta1:E, 3ta1:F, 3ta2:A, 3ta2:B, 3ta2:C
9	3lf0:B	112	113	0.5345	0.5536	0.5487	2.11e-35	3lf0:C
10	2ns1:B	113	113	0.5086	0.5221	0.5221	1.33e-33	2nuu:G, 2nuu:H, 2nuu:I, 2nuu:J, 2nuu:K, 2nuu:L
11	2rd5:D	126	110	0.5086	0.4683	0.5364	1.74e-31	2rd5:C
12	4cnz:E	112	112	0.4914	0.5089	0.5089	5.03e-31	4cnz:C, 4cnz:F, 4co0:A, 4co0:B, 4co1:A, 4co1:B, 4co2:A, 4co2:B, 4co3:A, 4co3:B, 3mhy:A, 3mhy:C, 3mhy:B
13	3ta0:C	99	107	0.5000	0.5859	0.5421	2.92e-30	3ta0:A, 3ta0:B, 3ta0:D, 3ta0:E, 3ta0:F
14	2eg2:A	95	112	0.4914	0.6000	0.5089	5.44e-29
15	4c3k:D	101	112	0.4914	0.5644	0.5089	1.12e-27	4c3k:A, 4c3k:E, 8wm7:F, 2xzw:E
16	6yc7:A	105	112	0.4569	0.5048	0.4732	1.83e-27	6yc7:B, 6yc7:E, 6yc7:C
17	8wm7:G	94	107	0.4914	0.6064	0.5327	2.19e-27
18	3lf0:A	99	112	0.4569	0.5354	0.4732	7.78e-27
19	1ul3:B	94	112	0.5086	0.6277	0.5268	9.70e-27	1ul3:C
20	4usj:C	142	110	0.4655	0.3803	0.4909	5.87e-26	4usi:A, 4usi:C, 4usi:B, 4usj:D
21	5l9n:A	92	107	0.4483	0.5652	0.4860	1.07e-25
22	4ozn:A	116	114	0.4741	0.4741	0.4825	6.12e-25	4ozj:A, 4ozn:C
23	2gnk:A	95	112	0.4310	0.5263	0.4464	1.94e-23
24	4cnz:A	100	112	0.4310	0.5000	0.4464	4.72e-23	4cny:A, 4cnz:B, 4cnz:D, 4co4:A, 4co4:C, 4co4:B, 3o5t:B, 5ovo:B
25	4rx6:B	115	114	0.4052	0.4087	0.4123	2.06e-22	4r25:A, 4rx6:A, 4rx6:D
26	2o66:B	108	109	0.4310	0.4630	0.4587	4.21e-22	2o66:A, 2o66:C, 2o67:A, 2o67:B, 2o67:C
27	6yc7:F	94	112	0.3966	0.4894	0.4107	1.43e-21
28	7o4x:A	103	112	0.4138	0.4660	0.4286	1.05e-20
29	1v3s:A	97	107	0.4138	0.4948	0.4486	2.97e-19	1v3s:B, 1v3s:C, 1v9o:A, 1v9o:B, 1v9o:C
30	4ozl:A	104	114	0.4224	0.4712	0.4298	1.09e-17	4ozn:B
31	8rf0:A	2780	70	0.2069	0.0086	0.3429	0.32	8rfe:A, 8rfg:A
32	3mdy:A	320	38	0.1293	0.0469	0.3947	1.5	3mdy:C
33	1tdq:B	126	36	0.0776	0.0714	0.2500	3.5
34	5x80:A	137	44	0.1121	0.0949	0.2955	4.4	5hso:A, 5hso:C, 5hso:D, 5hso:B, 5x7z:A, 5x80:B
35	5h7l:A	694	56	0.1207	0.0202	0.2500	5.6	5h7k:A, 5h7l:B
36	6efn:A	383	86	0.1724	0.0522	0.2326	7.9
37	5d3m:A	280	27	0.1034	0.0429	0.4444	9.2	8bmp:A, 8bmq:A, 8bms:A, 5d3m:E
38	2wpw:A	328	80	0.1983	0.0701	0.2875	9.3	2wpw:B, 2wpw:C, 2wpw:D, 2wpx:A, 2wpx:B

[Back]