GSKENMATLFTIWCTLCDRAYPSDCPEHGPVTFVPDTPI
The query sequence (length=39) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2l9z:A | 39 | 39 | 1.0000 | 1.0000 | 1.0000 | 8.73e-25 | |
2 | 3ray:A | 159 | 27 | 0.3077 | 0.0755 | 0.4444 | 3.66e-04 | |
3 | 4ijd:A | 215 | 28 | 0.2564 | 0.0465 | 0.3571 | 0.024 | 4ijd:B, 6nm4:A, 6nm4:B |
4 | 4c1q:A | 173 | 28 | 0.2564 | 0.0578 | 0.3571 | 0.040 | 4c1q:B |
5 | 8i02:F | 235 | 28 | 0.2821 | 0.0468 | 0.3929 | 0.40 | |
6 | 1keu:A | 361 | 36 | 0.3333 | 0.0360 | 0.3611 | 0.51 | 1g1a:A, 1g1a:B, 1g1a:C, 1g1a:D, 1keu:B, 1kew:A, 1kew:B |
7 | 8jjr:c | 86 | 22 | 0.3077 | 0.1395 | 0.5455 | 2.4 | 8jw0:c, 8jze:c, 8jzf:c |
8 | 4ufc:B | 788 | 11 | 0.2051 | 0.0102 | 0.7273 | 2.5 | 4ufc:A |
9 | 8rq4:A | 1402 | 21 | 0.2308 | 0.0064 | 0.4286 | 4.5 | |
10 | 7cma:A | 155 | 12 | 0.1795 | 0.0452 | 0.5833 | 5.7 | 7cma:C |