GSHMTDLAGPTITPNLQLVYVSNVERSTDFYRFIFKKEPVFVTPRYVAFPSSGDALFAIWSGGEEPVAEIPRFSEIGIML
PTGEDVDKLFNEWTKQKSHQIIVIKEPYTDVFGRTFLISDPDGHIIRVCPLD
The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3sk2:A | 132 | 132 | 1.0000 | 1.0000 | 1.0000 | 2.66e-96 | 3sk2:B |
2 | 1c39:A | 152 | 68 | 0.1742 | 0.1513 | 0.3382 | 0.44 | 1c39:B, 3k41:A, 3k41:B, 3k42:A, 1m6p:A, 1m6p:B, 2rl8:A, 2rl8:B, 2rl9:A, 2rl9:B, 2rlb:A, 2rlb:B |
3 | 4jd1:B | 148 | 104 | 0.2197 | 0.1959 | 0.2788 | 0.77 | 5f6q:A, 5f6q:B, 4ir0:A, 4ir0:B, 4jd1:A |
4 | 2dhr:A | 458 | 74 | 0.1439 | 0.0415 | 0.2568 | 1.0 | 2dhr:B, 2dhr:C, 2dhr:D, 2dhr:E, 2dhr:F, 4eiw:A, 4eiw:B, 4eiw:C, 4eiw:D, 4eiw:E, 4eiw:F, 1iy0:A, 1iy1:A |
5 | 6qig:A | 581 | 87 | 0.2121 | 0.0482 | 0.3218 | 1.4 | 3ghm:A, 3ghn:A, 3vn4:A |
6 | 5gan:B | 1781 | 99 | 0.1970 | 0.0146 | 0.2626 | 1.7 | 4bgd:A, 5gao:B, 5gap:B, 5nrl:B, 5zwm:D, 5zwo:D |
7 | 7n7g:A | 138 | 110 | 0.1970 | 0.1884 | 0.2364 | 2.6 | 7n7g:B |
8 | 4hg0:A | 232 | 30 | 0.0758 | 0.0431 | 0.3333 | 3.0 | 3nqr:A, 3nqr:B, 3nqr:C, 3nqr:D, 5yz2:A, 5yz2:B |
9 | 3oi8:A | 156 | 30 | 0.0758 | 0.0641 | 0.3333 | 3.2 | 3oi8:B |
10 | 6bbx:A | 121 | 115 | 0.2273 | 0.2479 | 0.2609 | 4.1 | 6bbx:B, 5ujp:A, 5ujp:B, 5umx:A, 5umx:B, 5umy:A, 5umy:B, 5w27:A, 5w27:B |