GSHMSDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTLGLDLRVATMEGKKIVEDILKSET
The query sequence (length=77) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6zlc:A | 77 | 77 | 1.0000 | 1.0000 | 1.0000 | 3.75e-53 | 6sx0:A, 6sx0:B, 6sx2:A, 6sx2:B, 6zlc:B |
2 | 2z0a:A | 72 | 71 | 0.5974 | 0.6389 | 0.6479 | 8.21e-31 | 2z0a:C, 2z0a:D, 2zko:A, 2zko:B |
3 | 4q56:A | 101 | 18 | 0.1169 | 0.0891 | 0.5000 | 1.0 | |
4 | 3hq7:A | 304 | 26 | 0.1688 | 0.0428 | 0.5000 | 1.7 | |
5 | 3hq6:A | 324 | 26 | 0.1688 | 0.0401 | 0.5000 | 1.7 | 3hq6:B, 3hq8:A, 3hq8:B, 3hq9:A, 3hq9:B |
6 | 4g9i:A | 766 | 51 | 0.1948 | 0.0196 | 0.2941 | 4.3 | 4g9i:B, 4g9i:C, 4g9i:D, 4g9i:E, 4g9i:F |
7 | 8dk2:C | 723 | 53 | 0.2338 | 0.0249 | 0.3396 | 6.0 | 8dk2:D |
8 | 8hyk:A | 306 | 21 | 0.1039 | 0.0261 | 0.3810 | 6.1 | 7x4p:A |